KEGG   Monodelphis domestica (opossum): 100021399
Entry
100021399         CDS       T01031                                 

Gene name
KITLG
Definition
(RefSeq) KIT ligand
  KO
K05461  KIT ligand
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo04010  MAPK signaling pathway
mdo04014  Ras signaling pathway
mdo04015  Rap1 signaling pathway
mdo04072  Phospholipase D signaling pathway
mdo04151  PI3K-Akt signaling pathway
mdo04640  Hematopoietic cell lineage
mdo04916  Melanogenesis
mdo05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100021399 (KITLG)
   04014 Ras signaling pathway
    100021399 (KITLG)
   04015 Rap1 signaling pathway
    100021399 (KITLG)
   04072 Phospholipase D signaling pathway
    100021399 (KITLG)
   04151 PI3K-Akt signaling pathway
    100021399 (KITLG)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100021399 (KITLG)
  09152 Endocrine system
   04916 Melanogenesis
    100021399 (KITLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100021399 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mdo04052]
    100021399 (KITLG)
Cytokines and growth factors [BR:mdo04052]
 Growth factors
  Growth factors (RTK binding)
   100021399 (KITLG)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 100021399
NCBI-ProteinID: XP_007503199
Ensembl: ENSMODG00000020515
UniProt: A0A5F8GDP1
LinkDB
Position
8
AA seq 273 aa
MKKTQTWIITCIYLQLLLFNPLVKTKGICGNPVTDDVKEITTLVANLPNDYMIPLKYVPD
MELLPNHCWLHLMVPELARSLNNLLDKFSKISSSLSNYSIIDKLIKIIDDLMGCLEEKNK
NFRKQNIHIYKRDSFNPEDFFRFFNKSIDAFKEYEETSEHSNCVLPSTIGPERDSRVNVT
KPFLLPPVAASSLRNDSSSSNRKAAGSTKDPSVQWVAIVLPSLFSLVLGFVLGALYWKKK
QMNLKMEVENIETSEEDNEISMLQENDGEFQEV
NT seq 822 nt   +upstreamnt  +downstreamnt
atgaagaagacacaaacttggattatcacttgcatttatcttcagctgctcctattcaac
cctctcgtcaaaactaaagggatctgtgggaatcctgtgaccgatgatgtgaaagagatt
acaacattggtggcaaatcttccgaatgactatatgatacctcttaagtatgtccccgat
atggaactcttgcctaatcattgttggttacatttgatggtgcccgaattggccaggagc
ctgaataacctcttggacaaattttccaaaatttccagtagtctgagtaattattcaatc
atcgataaactcataaaaataattgatgacctgatgggatgcttagaagagaaaaataag
aatttcagaaaacaaaatatccacatttataaacgagactcattcaatcctgaagacttt
tttagattctttaataaatccatcgatgcctttaaggaatatgaagaaacatctgagcat
agcaactgtgtcctgccttcaacaatagggcctgagagagattccagggtcaatgtcaca
aaaccatttttgttaccccccgttgcagccagctcccttaggaatgacagcagtagcagt
aataggaaggcagcaggatccactaaagacccaagtgtgcaatgggtagccattgtgtta
ccctcactattttctcttgtacttggctttgttcttggagccttatactggaagaaaaaa
caaatgaatcttaaaatggaagttgaaaacatagagactagtgaagaggataatgagata
agtatgttgcaagaaaatgatggagaatttcaagaagtgtaa

DBGET integrated database retrieval system