KEGG   Monodelphis domestica (opossum): 100021421
Entry
100021421         CDS       T01031                                 

Gene name
CACNA1C
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 C
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo04010  MAPK signaling pathway
mdo04020  Calcium signaling pathway
mdo04022  cGMP-PKG signaling pathway
mdo04024  cAMP signaling pathway
mdo04260  Cardiac muscle contraction
mdo04261  Adrenergic signaling in cardiomyocytes
mdo04270  Vascular smooth muscle contraction
mdo04713  Circadian entrainment
mdo04720  Long-term potentiation
mdo04723  Retrograde endocannabinoid signaling
mdo04724  Glutamatergic synapse
mdo04725  Cholinergic synapse
mdo04726  Serotonergic synapse
mdo04727  GABAergic synapse
mdo04728  Dopaminergic synapse
mdo04742  Taste transduction
mdo04911  Insulin secretion
mdo04912  GnRH signaling pathway
mdo04921  Oxytocin signaling pathway
mdo04924  Renin secretion
mdo04925  Aldosterone synthesis and secretion
mdo04927  Cortisol synthesis and secretion
mdo04929  GnRH secretion
mdo04930  Type II diabetes mellitus
mdo04934  Cushing syndrome
mdo04935  Growth hormone synthesis, secretion and action
mdo05010  Alzheimer disease
mdo05020  Prion disease
mdo05022  Pathways of neurodegeneration - multiple diseases
mdo05031  Amphetamine addiction
mdo05410  Hypertrophic cardiomyopathy
mdo05412  Arrhythmogenic right ventricular cardiomyopathy
mdo05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100021421 (CACNA1C)
   04020 Calcium signaling pathway
    100021421 (CACNA1C)
   04024 cAMP signaling pathway
    100021421 (CACNA1C)
   04022 cGMP-PKG signaling pathway
    100021421 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100021421 (CACNA1C)
   04929 GnRH secretion
    100021421 (CACNA1C)
   04912 GnRH signaling pathway
    100021421 (CACNA1C)
   04921 Oxytocin signaling pathway
    100021421 (CACNA1C)
   04935 Growth hormone synthesis, secretion and action
    100021421 (CACNA1C)
   04924 Renin secretion
    100021421 (CACNA1C)
   04925 Aldosterone synthesis and secretion
    100021421 (CACNA1C)
   04927 Cortisol synthesis and secretion
    100021421 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100021421 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    100021421 (CACNA1C)
   04270 Vascular smooth muscle contraction
    100021421 (CACNA1C)
  09156 Nervous system
   04724 Glutamatergic synapse
    100021421 (CACNA1C)
   04727 GABAergic synapse
    100021421 (CACNA1C)
   04725 Cholinergic synapse
    100021421 (CACNA1C)
   04728 Dopaminergic synapse
    100021421 (CACNA1C)
   04726 Serotonergic synapse
    100021421 (CACNA1C)
   04720 Long-term potentiation
    100021421 (CACNA1C)
   04723 Retrograde endocannabinoid signaling
    100021421 (CACNA1C)
  09157 Sensory system
   04742 Taste transduction
    100021421 (CACNA1C)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100021421 (CACNA1C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100021421 (CACNA1C)
   05020 Prion disease
    100021421 (CACNA1C)
   05022 Pathways of neurodegeneration - multiple diseases
    100021421 (CACNA1C)
  09165 Substance dependence
   05031 Amphetamine addiction
    100021421 (CACNA1C)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100021421 (CACNA1C)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100021421 (CACNA1C)
   05414 Dilated cardiomyopathy
    100021421 (CACNA1C)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100021421 (CACNA1C)
   04934 Cushing syndrome
    100021421 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mdo04040]
    100021421 (CACNA1C)
Ion channels [BR:mdo04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100021421 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans CAC1F_C Ca_chan_IQ GPHH PKD_channel Glyco_hydro_cc DUF4834
Other DBs
NCBI-GeneID: 100021421
NCBI-ProteinID: XP_016280957
LinkDB
Position
8
AA seq 2227 aa
MFQAFKSTTPAYQSLPNHLPAESEEKFKGTLVHEVHLNCFYISHEGSNYGSPRPAHANMN
ANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTASSTQRKRQQYGKQKK
QGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDD
SNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAI
LEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHI
ALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGLTDAPVEDDPSPCALDTGHGRQCQNGTI
CKAGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVGRDWPWIYFVTLIII
GSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPEN
EDEGMDEEKPRNRSTPAGMIDKKKGKFSWFSHSTETHGNVPLCSVCVCSVYVCVCMHRIS
KSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPHWLTEVQDT
ANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETKIMSPLGISV
LRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFN
FDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFI
CGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQEVEKPAVEET
KEEKIELKSITADGESPPTTKINVDDLQPNENEEKGPYPNPEAGGEEEEEEPEMPVGPRP
RPLSELHLKEKAVPMPEASAFFIFGHNNRFRLQCHRIVNNNVFTNLILFFILLSSISLAA
EDPVRHNSFRNQILFYFDIVFTTIFTIEIALKILGNADYVFTSIFTLEIILKMTAYGAFL
HKGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVV
QCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYTCTDSSKQTEAECKGNYITYKDG
EVDHPIIQPRSWENSKFDFDNVLTAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYR
VEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPL
RRYIPKNQHQYKVWYVVNSTYFEYLMFILILLNTICLAMQHYGQSCLFKIAMNILNMLFT
GLFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSIIDVILSETNHYFCDAWNTFDALIV
VGSIVDIAITEVNPTEHTQCSPSMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLW
TFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFR
CATGEAWQDIMLACLPGKKCAPESEPNNTTEAETLCGSSFAVFYFISFYMLCAFLIINLF
VAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFG
KLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIIKK
IWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSL
QAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVSYYQ
SDGRSSFPQTFTTQRPLHINKAGNSQGDTESPSHEKLVDSTFTPSSYSSSGSNANINNAN
NTALGRFPCPTGYPSTVSTVEGHGTPLSPAIRVHETAWKLSSRRYHSRDSRIAMVCPEEA
APNRTYEGNVNEDTEYCSEPSLISTEMLSYQDDENRQLTPPEDKTRQSTKRGFLHSASLG
RRASFHLECLKRQKNQGGDISQKTVLPLHLVHHQALAVTGLSPLLQRSHSPNTTFPRPSA
TPPATPHGQAWPLQPIPTLWLEGAESVEKLNSSFPSVHCSSWYAENANCGGSRGSTSRRA
RPVSLTVPSQAGATGRQFHGSASSLVEAVLISEGLGQFAQDPKFIEVTTQELADACDMTI
EEMENAADNILSGSSKQSPNGNLLPFVNCRDPGQNQAGGEEEEGMPNPECRKSEEELQDS
RVYISSL
NT seq 6684 nt   +upstreamnt  +downstreamnt
atgtttcaagcttttaagtcaaccactcctgcatatcagtcactacctaatcaccttcca
gcagaatcagaggagaagtttaaaggtactttggtgcatgaagttcatctcaactgtttc
tacatctcacatgaaggttccaactatgggagccctcgcccagctcatgccaacatgaat
gccaatgccgcggcagggcttgctcctgagcacatccccaccccgggagcggccctatca
tggcaggcggccattgatgctgcccggcaagccaagctgatgggcagcgctggcaatgct
accatctccactgccagttctactcagcggaaacggcagcagtatggaaagcagaagaaa
caaggaagcacaacagccactcgcccaccccgtgcattgctgtgcctgaccctgaaaaac
cccatccgaagagcgtgtataagcattgttgaatggaaaccatttgaaatcattatttta
ctgacaatttttgccaattgtgtggccttagcgatctatattccctttccagaagatgat
tccaatgccaccaattccaacctggaacgagtggaatatctctttctcatcatttttaca
gttgaagcatttttaaaagtaatagcctatggacttctctttcaccccaatgcttacctc
cgcaatggttggaatttactagattttataattgtggtagtagggctgtttagtgcaatt
ttagaacaagcaaccaaagcagatggggcaaatgcattaggaggaaagggggctggattt
gatgtaaaggccctgagggctttccgagtgctgcgccccttacgtctggtgtctggagta
ccaagtctacaagtggttttaaattccatcatcaaggccatggtcccgctgctgcatatt
gccctgcttgtgctatttgtcataatcatctatgccatcattggactggagctcttcatg
gggaagatgcacaagacttgctacaaccaagagggtttaacagatgccccagtagaagat
gacccctctccttgtgcccttgacacgggacatggacggcagtgccagaatggtacaata
tgtaaagcagggtgggatggacccaaacacggcatcaccaacttcgacaatttcgccttc
gccatgttaacggtgttccagtgcattacaatggagggttggacagatgtgctgtactgg
gtcaatgatgccgtaggaagggactggccctggatctattttgttacactaatcatcata
gggtcattttttgttcttaacttggttctcggtgtccttagcggagagttttccaaagag
agggagaaggcaaaggctcggggagacttccaaaagctgcgagagaagcagcagctggaa
gaagatctcaagggctacctggactggatcactcaagctgaagatattgaccctgagaat
gaagatgaaggcatggatgaggagaagcccagaaacagaagcactccggctggcatgatt
gataagaagaaagggaagttttcttggtttagtcactccacagaaacccatggtaatgtt
ccactgtgctctgtgtgtgtgtgcagtgtgtatgtgtgcgtgtgtatgcatcgaatctcc
aaatcaaagttcagtcgctattggcgccgatggaaccggttctgcagaaggaagtgccgg
gcagcagtcaaatccaatgttttctactggcttgttattttccttgtgttcctcaacacc
cttaccatcgcctcagaacactacaaccagccccactggctcacagaagtccaagacact
gccaacaaggccctgctggctcttttcactgcagagatgctgctgaagatgtacagcctt
ggcctccaggcctattttgtgtctctgttcaaccgctttgactgcttcatcgtgtgtgga
ggaatcctggagaccatcctggtagagaccaagatcatgtcccccctggggatctccgtg
ttgagatgtgtccggctgttgaggatatttaaaatcacaaggtattggaactccttgagc
aacctggtagcatcattactgaattcggtgcgatcaattgcctcactcttgctgctcctc
tttctcttcatcatcatcttctctctcctggggatgcagctctttggtggaaagttcaac
ttcgatgagatgcagacccggaggagtacattcgataatttcccccagtctcttctcact
gtgtttcagatcctgaccggggaggactggaattcggtgatgtatgatgggatcatggct
tatggagggccctcttttccagggatgttagtctgtatttacttcatcatccttttcatc
tgtggaaactacatcttgctaaatgtgttcttggctattgctgtggacaatctggctgat
gctgagagcctcacatctgcccagaaagaagaggaagaggaaaaagaaaggaagaaacta
gccaggactgccagccctgagaagaagcaagaggtggaaaagccagctgtggaggagact
aaagaggaaaaaattgagctaaagtcaattactgctgatggggaatctccacctaccact
aagatcaatgtggatgacctccaacccaatgaaaatgaggagaaaggtccctatcccaac
ccagaagctggaggagaagaagaggaggaggagcctgagatgcctgtgggtccacgcccc
cgcccactctctgagttgcacctcaaggagaaggcagtacccatgccagaagccagtgca
tttttcatctttggccataacaacaggttccgtcttcagtgccaccgaattgtcaacaac
aacgtctttaccaacttgatcctcttcttcatactgcttagcagcatctccctggctgct
gaggacccagtccggcacaactcctttcggaaccaaattctgttttattttgatatagtt
tttactaccattttcaccattgaaattgctctgaagatcctaggcaatgcagactatgtc
ttcactagtatctttacattagaaattatccttaagatgaccgcctatggggctttcctc
cacaagggctctttctgcaggaactacttcaacatcttggacctgctcgtggtcagcgtg
tccctgatctccttcggtatccagtccagtgccatcaatgttgtcaagatcttaagagtt
cttagagttctcagacccctgagagcaatcaacagagccaagggactaaagcatgtggtc
cagtgtgtgtttgttgctatccgaaccatagggaacattgtgattgtcaccacacttctg
cagttcatgtttgcctgcattggggtacagctgttcaagggtaaactctacacctgtaca
gacagttccaaacagactgaggcagaatgcaagggcaactatatcacatacaaagatggt
gaagtagaccatcccattatccagccccgaagttgggagaatagcaaatttgactttgac
aatgtcttgacagccatgatggccctctttactgtttccacctttgaggggtggccagag
cttctgtaccgatccatcgactcacacactgaagataagggacccatctacaactaccga
gtagagatctccatcttcttcatcatctacatcattatcatcgccttctttatgatgaat
atctttgtgggtttcgtcattgtcaccttccaggagcagggagaacaggagtacaagaac
tgtgaactggacaagaaccagcggcagtgtgttgagtacgcccttaaggctcggcccttg
agaaggtacattcccaagaatcaacaccagtacaaagtgtggtatgtggttaattccacg
tattttgagtacctgatgttcatcctcatccttctcaacaccatctgcttggccatgcag
cactacggtcagagctgtcttttcaaaatcgccatgaacattctcaacatgctcttcact
ggcctcttcaccgtcgagatgatcctgaagctcattgcattcaaacccaagggttacttt
agtgatccttggaatgtttttgacttcctgatcgtaattggaagcattattgacgtcatt
ctcagtgagactaatcactatttctgtgatgcatggaatacatttgacgccttgattgtt
gtgggtagcattgttgatatagcaatcaccgaggtaaacccaactgaacatacccaatgc
tctccctctatgaatgcagaggagaactcccggatctccatcaccttcttccgtcttttc
cgtgtcatgcgtctcgtcaagttgctgagccgtggggagggcatccggaccctgctttgg
actttcatcaaatctttccaggctctaccctatgtggctcttctaatagtgatgttgttc
ttcatctacgctgtcattggaatgcaggtatttggcaaaattgccctgaatgataccaca
gaaatcaatcggaacaacaactttcagaccttccctcaagctgtgctgttactcttcagg
tgtgccacaggggaagcatggcaagatatcatgctagcctgcctgccaggaaagaaatgt
gcccctgagtctgagccgaataacactactgaagcggaaacactctgtggcagcagtttt
gctgtgttctattttatcagtttttacatgctctgtgccttcctgatcatcaacctcttt
gtagctgttatcatggacaacttcgactacctgacaagagactggtccatcctaggtcct
catcacttggatgaattcaaaaggatctgggcagaatatgaccctgaagccaagggtcgt
atcaaacacctggatgtggtgaccttactccggaggatccaacccccacttgggtttgga
aagctatgccctcatcgagtagcatgcaaacgtctggtatccatgaatatgcctctgaac
agtgatgggactgttatgttcaatgccaccttatttgccctggtcaggacagccttgagg
attaaaacagaagggaatctggaacaagccaatgaagaattgcgagcaattatcaaaaaa
atctggaaacgaacaagcatgaagctactagaccaagtggtacccccagcaggtgatgat
gaggtgaccgttgggaagttttatgctaccttcctgatccaagagtatttccgaaaattt
aagaaacgcaaagagcaagggctagtgggcaagccctcccaaaggaatgcactgtcactt
caggctggtcttcgtacactgcatgacattggaccagagattcgacgggccatttctgga
gacctgacagctgaggaggagttggacaaggctatgaaggaagctgtttctgctgcctct
gaagatgacatctttaggagggccggtggcctgtttggcaatcatgtcagctactaccaa
agcgatggtcgaagctccttcccccagaccttcaccacccagcgcccactgcatatcaac
aaggcgggtaacagccaaggtgacacggagtcgccatcccatgagaaactggtggattcc
acattcactcccagcagctactcatcctctggttccaatgccaacatcaacaacgccaac
aacactgccctgggccgcttcccctgtcccaccggttaccccagtacggtcagcacagtg
gagggccatgggacccccttatcccctgccatccgggtgcacgagacagcatggaagctc
agctccaggagataccactcccgggacagccggatagccatggtgtgtccagaggaggca
gcccccaacaggacctatgaaggcaatgtgaatgaggacacagaatactgcagtgagccc
agcctgatctccactgagatgttatcctatcaggatgatgagaatagacagctgacacca
ccagaagacaagaccaggcagtctacaaagagaggattcctccactctgcctcactaggt
cggagagcctccttccatttggagtgtctaaagagacaaaagaaccaaggaggagacatt
tctcagaagacagtgctgcccttgcatctggttcatcaccaggcattggcagtgacaggc
ctcagccctctccttcagagaagccattctccaaacaccacattccccaggccaagtgcc
acccccccagcaactcctcacggccaagcctggcccctccagcccattcctacactgtgg
ctagaaggagctgagtctgtcgagaagctcaacagcagcttcccatcagtccactgcagc
tcctggtatgcagagaatgccaactgcggaggcagcaggggcagcacctcccggagagcc
cggccagtttccctcactgtgcccagccaggctggggcaactggtagacaattccatggc
agtgctagcagtctagttgaagcggtcttgatttcggaaggactgggacaatttgcgcaa
gatcccaagttcatcgaagtcacaacccaagaacttgctgatgcctgtgatatgacaata
gaggaaatggagaatgcggctgacaatatcctcagtggtagcagcaagcagagccccaat
ggcaacctattgccttttgttaactgcagggacccggggcagaaccaagcaggtggtgag
gaagaagagggaatgcccaaccccgaatgtcgaaagagtgaggaggaactccaggacagc
agggtttatatcagcagcctgtag

DBGET integrated database retrieval system