KEGG   Monodelphis domestica (opossum): 100022041Help
Entry
100022041         CDS       T01031                                 

Gene name
PFKP
Definition
(RefSeq) phosphofructokinase, platelet
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00010  Glycolysis / Gluconeogenesis
mdo00030  Pentose phosphate pathway
mdo00051  Fructose and mannose metabolism
mdo00052  Galactose metabolism
mdo01100  Metabolic pathways
mdo01200  Carbon metabolism
mdo01230  Biosynthesis of amino acids
mdo03018  RNA degradation
mdo04152  AMPK signaling pathway
mdo05230  Central carbon metabolism in cancer
Module
mdo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100022041 (PFKP)
   00030 Pentose phosphate pathway
    100022041 (PFKP)
   00051 Fructose and mannose metabolism
    100022041 (PFKP)
   00052 Galactose metabolism
    100022041 (PFKP)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    100022041 (PFKP)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    100022041 (PFKP)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    100022041 (PFKP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mdo01009]
    100022041 (PFKP)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mdo03019]
    100022041 (PFKP)
Enzymes [BR:mdo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100022041 (PFKP)
Protein phosphatases and associated proteins [BR:mdo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100022041 (PFKP)
Messenger RNA biogenesis [BR:mdo03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     100022041 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 100022041
NCBI-ProteinID: XP_001374019
Ensembl: ENSMODG00000006521
UniProt: F7E3N2
LinkDB All DBs
Position
8
AA seq 785 aa AA seqDB search
MAERHSEQIANRSLIGVGKVIAVLTSGGDAQGMNAAVRAVVRMGIYVGAKMFFVHEGYQG
MVDGGSNIVQVSWESVSSILQRGGTVIGSARCSAFRNREGRLKAAANLLEKGITNLCVIG
GDGSLTGANLFREEWSGLLDELAKNGKISKDDVKNYSHLNIVGLVGSIDNDFCGTDMTIG
TDSALHRIIEVVDAIMTTALSHQRTFVLEVMGRHCGYLALASALACGADWVFIPESPPED
DWEKHMVEKLSENRAHKKRLNIIIVAEGAIDAQNQPITSEKIKNLVVDELGFDTRVTILG
HVQRGGTPSAFDRILASRTGVEAVLALLEAKPETPACVVSLSGNHIVRLPLMECVKMTQA
VQKAMDKKDFKKAVKLRGRSFENNLQTYKLLSQKETTAEIPKSNFNVAVMNVGAPAAGMN
AAIRSAVRVGITEGHKMLVVNNGFEGLSKGEIKEFHWTCVRGWTGQGGSILGTKRTLPAM
YLEQIAEQIRTYKINGLLVVGGFEAYLGLLELSAAREKYKEFCIPMIMVPATVSNNIPGS
DFSIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLASMGGLSAGADVAYIF
EEKFDIRELQANVRHLTEKMKTNIQRGLVLRNENCNENYTTDFIYQLYSEEGKGVFDCRK
NVLGHMQQGGAPSPFDRNFATKISAKAMQWLTKKLQDNFQDGKVFVNDDDSVCLLGMRTR
TLLFQPVVELKKETDFEHRIPKEQWWLKLRPLMKILAKYKISYQVPSSAKLENIECRTRE
GNEAS
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcgtcatagcgagcagatcgcaaatcggagtctaattggtgttggcaaagtc
atcgcggtccttactagcggcggcgatgcccaaggaatgaatgcagctgttcgagctgtg
gtgcggatgggaatctatgtgggagccaaaatgttttttgtgcatgagggttatcaaggt
atggtagatggaggctctaatattgttcaagtgtcctgggaaagtgtttcaagtattctc
caaaggggaggaacagtcattggcagtgcacgttgttcagcattccgtaaccgggaaggc
cgtttaaaagcagctgcaaacttgcttgaaaaaggaattactaatctgtgtgtgattggt
ggggatggaagcttaactggagctaacctttttcgggaagaatggagtggactattggac
gaattggctaaaaatggtaaaatcagtaaagatgacgtcaagaattattcccacctcaac
atcgtggggttggtgggttctatagacaatgacttctgtgggacggatatgacaattggc
actgactcggctttgcacagaatcattgaagttgtggatgccatcatgaccactgctctg
agtcaccagaggacctttgttctggaggttatgggaagacattgtgggtacctggccctc
gcaagtgccttagcttgtggtgcagattgggtgtttattcctgaaagcccaccagaagac
gactgggaaaagcacatggtagaaaagctatcagagaatcgtgcccataagaagagactg
aacatcataattgtggcagaaggggcaattgatgcccaaaatcaacctattacttcagaa
aagattaagaatcttgtagttgatgagctgggatttgatactcgtgtgactatccttgga
catgtccaaagaggaggaaccccttcagcttttgacaggattttggctagtcgcacaggt
gtggaggcagtattggctcttcttgaggctaaaccggaaaccccagcatgtgttgtgtct
ttgtctggaaaccacatcgtgcgtctgcccctgatggagtgtgtaaaaatgactcaggct
gttcaaaaggcaatggataaaaaggattttaagaaggcagtgaaacttcgaggaaggagc
tttgagaacaacttacaaacctataaactactttctcagaaagaaacaacggcagagatt
ccaaagagcaattttaacgtggctgttatgaatgtgggtgctcctgctgcagggatgaac
gctgccatccgttcagcagtgagagtgggcatcactgagggtcataaaatgctggttgtc
aataatggctttgaaggattgtctaaaggtgagataaaagaattccactggacatgtgtt
agaggctggactggtcaaggaggatcaattcttggcacaaaacgtactctccctgcaatg
tatttggagcagattgctgaacagatacgtacttataaaatcaacggtcttttggttgtc
ggtggatttgaggcctacctgggattgctggaactgtcagctgcccgtgagaaatataag
gaattctgtattccaatgattatggttcctgctactgtatccaacaatatacccggttcc
gatttcagcattggtgcagacactgccctgaacactatcaccgatacctgtgatcgaatc
aagcagtccgcgagtgggaccaagaggcgagtcttcatcatcgagacgatgggcggctac
tgtggctacctggccagcatggggggcctctctgctggggccgacgtagcatatattttt
gaagaaaaatttgacatccgagaactacaggctaacgtgaggcatttgacagagaaaatg
aagaccaacatacaacgaggcctggtgctcagaaatgagaactgtaatgaaaattatacc
actgatttcatttaccaactctattctgaggaaggaaaaggtgtatttgattgcagaaag
aatgtcttgggtcacatgcaacagggtggagcgccttctccttttgacagaaactttgca
acaaaaatttctgccaaagctatgcagtggcttactaagaaactacaggacaactttcaa
gacggaaaagtatttgtcaacgatgatgattcagtttgtctgctaggaatgcgcacacgg
actctacttttccaacctgtggttgaactaaagaaggaaacagattttgagcacagaatt
cccaaagaacaatggtggttgaaactacgacctttgatgaaaattttggccaaatacaaa
atcagctatcaagttccctcttcagctaagctggaaaatatagaatgcagaacgagagaa
ggaaatgaagcctcataa

DBGET integrated database retrieval system