KEGG   Monodelphis domestica (opossum): 100022164Help
Entry
100022164         CDS       T01031                                 

Definition
(RefSeq) glutathione S-transferase omega-1-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00480  Glutathione metabolism
mdo00980  Metabolism of xenobiotics by cytochrome P450
mdo00982  Drug metabolism - cytochrome P450
mdo00983  Drug metabolism - other enzymes
mdo01524  Platinum drug resistance
mdo05200  Pathways in cancer
mdo05204  Chemical carcinogenesis
mdo05225  Hepatocellular carcinoma
mdo05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100022164
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100022164
   00982 Drug metabolism - cytochrome P450
    100022164
   00983 Drug metabolism - other enzymes
    100022164
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    100022164
   05204 Chemical carcinogenesis
    100022164
  09162 Cancers: Specific types
   05225 Hepatocellular carcinoma
    100022164
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100022164
  09176 Drug resistance: Antineoplastic
   01524 Platinum drug resistance
    100022164
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mdo02000]
    100022164
Enzymes [BR:mdo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100022164
Transporters [BR:mdo02000]
 Other Transporters
  Pores ion channels [TC:1]
   100022164
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C GST_C_2 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 100022164
NCBI-ProteinID: XP_001368758
Ensembl: ENSMODG00000010839
UniProt: F7BDE2
LinkDB All DBs
Position
1
AA seq 242 aa AA seqDB search
MSGESPRSLGKGSPQPGPVPLGVIRLYSMRFCPFAQRTRLVLKAKGIKHEVVNINLKNKP
EWFFKKHPLGLIPVLENSKGQLIHDSSITCEYLDEAYPGKKLFPEDPYEKALQKMNFEFL
SKIPSLAKDVIIAIQNNEHGTPKKEELCNEFNKLEEVLNRQKTTFLGGNSVSMIDYLIWP
WFERLELYEIPNCLDKTPALKLWVVAMKNDPIVAALLTDVKTFKGFYDLYFQNNPDAFDY
GL
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggcgagtctccccggagcctggggaaaggcagcccccagccaggccctgttccg
ttgggagttattcggctctacagcatgagattctgtccttttgcccagagaaccaggctc
gtcctaaaggccaaaggaatcaaacatgaggttgtcaatattaacttgaaaaacaagcct
gaatggttctttaagaagcatccccttggtctaataccagttctggagaacagcaagggt
cagctgatacatgactcttctatcacttgtgaatatctagatgaagcttatccaggaaag
aagttgtttccagaagatccatatgagaaagctttacaaaagatgaattttgaattttta
agtaagataccatctttggccaaggatgttattatagcaattcaaaacaatgaacatggt
acccctaagaaagaagaactctgtaatgaattcaacaaattggaggaggttcttaaccga
caaaagacaacttttcttggtggaaactctgtatctatgattgattacctcatctggccc
tggtttgaacggttggaactatatgagatacctaactgcttggacaaaacccctgctctg
aagctatgggttgtcgccatgaagaacgaccctatcgttgcagctctcctcactgatgtg
aagacatttaaaggcttctatgatctctactttcaaaataatcctgatgcctttgattat
ggtctgtga

DBGET integrated database retrieval system