KEGG   Monodelphis domestica (opossum): 100022318Help
Entry
100022318         CDS       T01031                                 

Gene name
ALPI
Definition
(RefSeq) alkaline phosphatase, intestinal
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00730  Thiamine metabolism
mdo00790  Folate biosynthesis
mdo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    100022318 (ALPI)
   00790 Folate biosynthesis
    100022318 (ALPI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mdo04147]
    100022318 (ALPI)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mdo00537]
    100022318 (ALPI)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     100022318 (ALPI)
Exosome [BR:mdo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100022318 (ALPI)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mdo00537]
 Enzymes
  100022318 (ALPI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 100022318
NCBI-ProteinID: XP_007486142
Ensembl: ENSMODG00000002592
LinkDB All DBs
Position
2
AA seq 522 aa AA seqDB search
MQGIFALFLVGLYFHTAKGEIPEEEENPSFWNRQAAEAIKTAQQLQPIQTAAKNLILFLG
DGMGVPTVTATRILKGKLSGNLGPETPLAMDRFPYVALSKTYNVDRQVPDSAGTATAYLC
GVKGNYKTIGLSAAARVDQCNSTFGNEVYSVLQRAKKAGKSVGVVTTTRVQHASPSGTYA
HVVNRDWYSDANMPADALRSGCKDIASQLISNVDIDVILGGGRKYMFPVGTPDPEYPNLS
SQNGIRRDDRNLVQEWLDARQGAKYVWDRQELLNAAENLEVTHIMGLFEPGDTKYDLQRN
TSVDPSLMEMTEVAIKILRRNPKGYYLFVEGGRIDHGHHDGNAHLALTEAVMFDSTIDKA
VQMTNEKDTLIAVTADHSHVFSFGGYTYRGSSIFGLAPSKAQDNKAYTSILYGNGPGYVN
GTRPDVKESVSEDVSYKQQAAVPLSSETHGGEDVAIFARGPQAHLFHGVQEETYVAHVMA
FAGCLEPYENCGLSWPNSSLQTSVSFLLLVLVWPFLLLAVQH
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgcagggaatattcgctctcttcctggtgggactttatttccacactgccaaaggcgaa
atcccagaagaagaagagaatcccagtttctggaaccggcaagctgcagaagccatcaaa
acagcccagcagttgcagcccatccagacggcagccaagaacctcatcctcttcctggga
gatgggatgggagtgcccacagtgacagccacccggatactcaaaggaaaactgagtgga
aatctgggccctgagacccccctggccatggaccggtttccctatgtggctctgtccaag
acgtacaatgtagacaggcaggtccccgacagcgcaggcacagctaccgcctacctctgt
ggcgtgaagggcaactacaaaaccatcggcctcagcgcggctgcccgggtggaccagtgc
aactcgacctttggcaatgaggtctactctgtactgcaacgagccaagaaagcagggaag
tcagtgggggtagtgaccaccacccgggtgcagcatgcctcgccctctggcacatatgcc
catgtagtaaaccgggactggtactcagatgccaacatgcctgctgacgccctgaggagt
ggttgtaaggacattgcttcccagctgatttccaatgtggacattgatgtgatcctaggt
gggggccgcaagtacatgtttccagtgggaactcctgatcctgaatacccaaacctcagc
agtcagaacgggatcaggagggatgaccggaaccttgtacaggaatggctggacgccaga
cagggagccaaatacgtgtgggaccgtcaagaactactgaatgccgcagaaaacctcgaa
gtgacacatatcatgggcctctttgaaccaggagacactaaatatgatctacagcgcaat
acttctgtagacccctcattgatggagatgactgaggttgccatcaaaatactcaggcga
aatcccaaaggatactacctctttgtggaaggaggtcgaattgaccatggccaccatgat
ggcaatgcacacttggccttgactgaggctgtcatgtttgactcaacaattgataaggct
gtccagatgactaatgaaaaggacactctgattgccgtcactgcggatcattcccatgtc
ttctctttcggcggctacacctacagaggcagctcaatctttggactggctcccagcaag
gcacaagataacaaagcatatacttccatcttatatggcaatggacctggatatgtgaat
ggtaccaggccagatgtcaaagaaagtgtcagtgaggacgtgtcctataagcagcaggca
gctgtgcctctgtcctcagagacccatggaggggaagatgtggccatcttcgcaagaggt
ccccaagcacacctattccatggtgtgcaggaggagacttatgtggctcatgttatggct
tttgctggctgcctggaaccctatgagaactgtgggctctcatggcccaatagtagcctc
cagacatcagtatcattcctgctgctggtccttgtctggcctttcctgctattagcagtt
cagcattga

DBGET integrated database retrieval system