KEGG   Monodelphis domestica (opossum): 100022664Help
Entry
100022664         CDS       T01031                                 

Definition
(RefSeq) 5-hydroxytryptamine receptor 3E-like
  KO
K04819  5-hydroxytryptamine receptor 3
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo04726  Serotonergic synapse
mdo04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    100022664
  09157 Sensory system
   04742 Taste transduction
    100022664
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mdo04040]
    100022664
Ion channels [BR:mdo04040]
 Ligand-gated channels
  Serotonin (5-HT3)
   100022664
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Motif
Other DBs
NCBI-GeneID: 100022664
NCBI-ProteinID: XP_007486154
LinkDB All DBs
Position
2
AA seq 367 aa AA seqDB search
MTSFLWVNMVWDNPFISWNPEECGGLTEISVAAKNLWLPDLFIIEFMDVDTTPTSLYAYV
HSSGRINYDKPMKVTSICNLDIFYFPFDQQNCTLTFSSFLYTVDHLLLGMEKEVWEITDN
SRDIIRTQGEWELLGINKATPKLIMGSSLYDQIMFHVTIRRRPRLYVINLLLPSGFLIAI
DALSFFLPVESGNRAPFKMTLLLGYTVFLLMMNDLLPASGTPLISVYFALCLSLMVVSLL
EAIFLTYLLNLVTTQPPPMPPWLHSLLLHYLRATDRCNKRSQKEPRGSGPNLIHLPGLME
PVVMATWVPGSSEAKLNGDPGSTRAPLEQEAQGRLTANMFLCSFLPDLTCLSLKDPAQES
HLIIVLS
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgacatcctttctctgggtgaatatggtttgggacaatccattcatcagctggaaccca
gaggaatgtgggggcttaacagaaatcagcgtggcggcaaagaacctctggctcccggac
ctcttcatcatagagttcatggacgtggacacaacccctaccagtctctatgcctatgtg
cacagcagtggccggatcaactatgataaacctatgaaggtgaccagcatctgtaacctg
gatatcttctacttcccctttgaccagcagaattgcaccctgaccttcagctctttcctg
tatacagtggatcacctgttgctgggcatggaaaaggaagtgtgggagatcacggacaat
tcgcgtgatatcattcggactcaaggcgaatgggaactcctgggcatcaacaaagcaacc
ccaaagttgataatgggttccagtctttatgaccagatcatgttccatgtgacaatccgg
cgccggcccagactttacgtcataaatctactgctgcctagtgggtttctgatcgcaatc
gatgccctgagcttcttcctgccagttgagagtggcaaccgagcccctttcaagatgacc
ctgctcctgggatacaccgtcttcctgctcatgatgaatgatttactgccagccagtggc
accccactcatcagtgtgtactttgctctgtgcttgtccctgatggtagtcagcctgctg
gaggccatcttcctcacctaccttctgaatctggttactacacagccccctcccatgccc
ccctggctccattcactgctgctgcactacctccgagcaacagaccgctgtaacaagagg
tctcagaaagaacccaggggctctggccccaacctcatccacctgcctgggctgatggag
ccagtcgttatggcaacatgggtaccaggatctagcgaggccaagctaaatggagatcca
ggatcaacgagggcaccgttggaacaggaggcccaggggcggctgacagctaacatgttc
ctctgctccttcttgccagacctaacctgtctgtcccttaaggatccagcccaggagagt
catctaatcattgtgttgtcctaa

DBGET integrated database retrieval system