KEGG   Monodelphis domestica (opossum): 100022756Help
Entry
100022756         CDS       T01031                                 

Gene name
HDAC2
Definition
(RefSeq) histone deacetylase 2
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo04110  Cell cycle
mdo04213  Longevity regulating pathway - multiple species
mdo04330  Notch signaling pathway
mdo04919  Thyroid hormone signaling pathway
mdo05016  Huntington disease
mdo05034  Alcoholism
mdo05165  Human papillomavirus infection
mdo05169  Epstein-Barr virus infection
mdo05200  Pathways in cancer
mdo05202  Transcriptional misregulation in cancer
mdo05203  Viral carcinogenesis
mdo05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    100022756 (HDAC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100022756 (HDAC2)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100022756 (HDAC2)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    100022756 (HDAC2)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    100022756 (HDAC2)
   05202 Transcriptional misregulation in cancer
    100022756 (HDAC2)
   05203 Viral carcinogenesis
    100022756 (HDAC2)
  09162 Cancers: Specific types
   05220 Chronic myeloid leukemia
    100022756 (HDAC2)
  09164 Neurodegenerative diseases
   05016 Huntington disease
    100022756 (HDAC2)
  09165 Substance dependence
   05034 Alcoholism
    100022756 (HDAC2)
  09172 Infectious diseases: Viral
   05169 Epstein-Barr virus infection
    100022756 (HDAC2)
   05165 Human papillomavirus infection
    100022756 (HDAC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mdo03036]
    100022756 (HDAC2)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100022756 (HDAC2)
Chromosome and associated proteins [BR:mdo03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     100022756 (HDAC2)
   HDAC complexes
    Sin3A-HDAC complex
     100022756 (HDAC2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100022756 (HDAC2)
  Chromatin remodeling factors
   NuRD complex
    100022756 (HDAC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 100022756
NCBI-ProteinID: XP_001368989
Ensembl: ENSMODG00000017860
UniProt: F6YIM6
LinkDB All DBs
Position
2
AA seq 488 aa AA seqDB search
MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
TAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVA
GAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQ
IFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLG
GGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYM
EKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEE
FSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKADVKEEEKSKDNSGEKTDTKGA
KSEQLSNP
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggcgtacagtcagggaggcggcaagaagaaagtctgctactactatgatggtgacatt
ggaaattattattatggacagggtcatcctatgaaaccccataggattcgcatgacccat
aacctgctactaaattatggcttgtatcgaaaaatggaaatatataggccccacaaagct
acagctgaagaaatgaccaagtatcacagtgatgaatacatcaaatttctgcgctcaata
agaccagataatatgtctgagtatagcaagcagatgcaaagatttaatgttggagaagat
tgtccagtgtttgatgggctttttgagttctgccagctgtcaactggtggctctgttgct
ggggcagtaaaattaaatagacaacagactgacatggctgttaactgggctggaggtctt
catcatgcaaagaagtcagaggcatctggtttctgttatgttaatgatattgtccttgcc
atcctagaactgctaaagtaccatcagagagtgctatacattgatattgatatccatcat
ggtgatggtgttgaggaagcattttatacaacagaccgtgtaatgactgtatcattccac
aaatatggtgaatactttccaggcacaggagacttgagggacattggtgcaggaaaaggc
aagtattatgctgtcaactttccaatgagagatggtatagatgatgagtcctatgggcag
atatttaaaccaataatatcgaaagtgatggagatgtatcagcctagtgcagtagtgttg
cagtgtggtgcagactcattatctggtgacagacttggttgtttcaatttaactgtcaaa
ggtcatgctaaatgtgtagaagttgtgaaaactttcaatttgccccttctgatgctggga
ggagggggatacactatccgtaatgttgctcggtgttggacatatgaaactgctgttgcc
ttagattgtgaaattccaaatgaactgccatacaatgattactttgagtattttggacca
gactttaaactgcacataagtccatcaaatatgacaaatcagaataccccagagtatatg
gagaagatcaaacaacgtttgtttgaaaacttgcgcatgttacctcatgcgcctggtgta
cagatgcaagccatccctgaagatgctgttcacgaagacagtggggatgaagatggggaa
gatccagacaaacgaatttctattcgagcatcagacaagcggatagcttgtgatgaagaa
ttttccgattctgaggatgaaggtgaaggagggcgtagaaatgtggctgatcataagaaa
ggagcaaaaaaagcaaggatagaagaagacaagaaggaaacagaagacaaaaaagcagat
gttaaagaagaagaaaagtctaaggacaacagtggtgaaaagacagacaccaaaggagcc
aaatcggaacagctcagcaatccttga

DBGET integrated database retrieval system