KEGG   Monodelphis domestica (opossum): 100022918
Entry
100022918         CDS       T01031                                 

Gene name
IKBKG
Definition
(RefSeq) inhibitor of nuclear factor kappa B kinase subunit gamma
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo01523  Antifolate resistance
mdo04010  MAPK signaling pathway
mdo04014  Ras signaling pathway
mdo04062  Chemokine signaling pathway
mdo04064  NF-kappa B signaling pathway
mdo04151  PI3K-Akt signaling pathway
mdo04210  Apoptosis
mdo04380  Osteoclast differentiation
mdo04620  Toll-like receptor signaling pathway
mdo04621  NOD-like receptor signaling pathway
mdo04622  RIG-I-like receptor signaling pathway
mdo04623  Cytosolic DNA-sensing pathway
mdo04625  C-type lectin receptor signaling pathway
mdo04657  IL-17 signaling pathway
mdo04658  Th1 and Th2 cell differentiation
mdo04659  Th17 cell differentiation
mdo04660  T cell receptor signaling pathway
mdo04662  B cell receptor signaling pathway
mdo04668  TNF signaling pathway
mdo04920  Adipocytokine signaling pathway
mdo05132  Salmonella infection
mdo05135  Yersinia infection
mdo05142  Chagas disease
mdo05145  Toxoplasmosis
mdo05160  Hepatitis C
mdo05161  Hepatitis B
mdo05162  Measles
mdo05163  Human cytomegalovirus infection
mdo05164  Influenza A
mdo05165  Human papillomavirus infection
mdo05166  Human T-cell leukemia virus 1 infection
mdo05167  Kaposi sarcoma-associated herpesvirus infection
mdo05168  Herpes simplex virus 1 infection
mdo05169  Epstein-Barr virus infection
mdo05170  Human immunodeficiency virus 1 infection
mdo05200  Pathways in cancer
mdo05203  Viral carcinogenesis
mdo05212  Pancreatic cancer
mdo05215  Prostate cancer
mdo05220  Chronic myeloid leukemia
mdo05221  Acute myeloid leukemia
mdo05222  Small cell lung cancer
mdo05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mdo05340  Primary immunodeficiency
mdo05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100022918 (IKBKG)
   04014 Ras signaling pathway
    100022918 (IKBKG)
   04064 NF-kappa B signaling pathway
    100022918 (IKBKG)
   04668 TNF signaling pathway
    100022918 (IKBKG)
   04151 PI3K-Akt signaling pathway
    100022918 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100022918 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100022918 (IKBKG)
   04621 NOD-like receptor signaling pathway
    100022918 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    100022918 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    100022918 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    100022918 (IKBKG)
   04660 T cell receptor signaling pathway
    100022918 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    100022918 (IKBKG)
   04659 Th17 cell differentiation
    100022918 (IKBKG)
   04657 IL-17 signaling pathway
    100022918 (IKBKG)
   04662 B cell receptor signaling pathway
    100022918 (IKBKG)
   04062 Chemokine signaling pathway
    100022918 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100022918 (IKBKG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100022918 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100022918 (IKBKG)
   05203 Viral carcinogenesis
    100022918 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100022918 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100022918 (IKBKG)
   05221 Acute myeloid leukemia
    100022918 (IKBKG)
   05220 Chronic myeloid leukemia
    100022918 (IKBKG)
   05215 Prostate cancer
    100022918 (IKBKG)
   05222 Small cell lung cancer
    100022918 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    100022918 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100022918 (IKBKG)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100022918 (IKBKG)
   05135 Yersinia infection
    100022918 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100022918 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    100022918 (IKBKG)
   05162 Measles
    100022918 (IKBKG)
   05164 Influenza A
    100022918 (IKBKG)
   05161 Hepatitis B
    100022918 (IKBKG)
   05160 Hepatitis C
    100022918 (IKBKG)
   05168 Herpes simplex virus 1 infection
    100022918 (IKBKG)
   05163 Human cytomegalovirus infection
    100022918 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100022918 (IKBKG)
   05169 Epstein-Barr virus infection
    100022918 (IKBKG)
   05165 Human papillomavirus infection
    100022918 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100022918 (IKBKG)
   05142 Chagas disease
    100022918 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100022918 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mdo01001]
    100022918 (IKBKG)
Protein kinases [BR:mdo01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   100022918 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 JIP_LZII LLC1 Shugoshin_N
Other DBs
NCBI-GeneID: 100022918
NCBI-ProteinID: XP_007506962
Ensembl: ENSMODG00000009175
UniProt: F7ADE2
LinkDB
Position
X
AA seq 547 aa
MNEHHCKSQPCEMVQPNRGPSGDSETLGEGSSLGKSAMLHLPSSQVSPEALQRFLEENQE
LRDALRQSNQMLRERYQEFVNFQANQKEEKEFLMRKFQEARTLVEKLKTEKLELKRQKEK
ALQESEKGQIPGETEREAWRILKEQLEDRLQHLEETSEGLQKEKQALLLENQELRTKTEI
QPQRLPETESLQEASDRSVDSNDLLTKVQDVENENTVLKEELASLRGKMAHLAVREKQVE
RRAEQQLQALKRQVEQLTEDKGSVKAQVTSLLGELQESQSRLELSNKDKQVLEDRARTVT
EKLKQLESENEQLHKQHSVQVDQLRMQTQNVEAALRMERQAASEEKRKLAQLQVAYHQLF
QEYDNHIKKSQASSERSRGMDLQLEDLNQQLQQAEEALVAKQELIDKLKEEAEQHKTVME
TIPVLKAQADIYKADFQAERQAREKLAERKELLQDQLEQLQREYSKLRADSKESTRIEDM
RKRHVENPQAALPQPVHLVNHHLPFHPLPPGQRRSLPDQQPDFCCPKCLYQAPDIDTLQI
HVMECIE
NT seq 1644 nt   +upstreamnt  +downstreamnt
atgaatgaacatcactgtaagagtcagccttgtgagatggtacagcccaacaggggtcca
tcgggagattctgagacccttggtgaagggtcttccctggggaaatcagccatgctgcat
ctcccttccagccaagtctctccagaggccctgcagcgcttcttggaggagaaccaggag
ctcagagatgccttacgacagagcaaccagatgcttcgagagcgctatcaagagtttgtg
aacttccaggccaaccagaaggaggagaaggaatttctcatgagaaaatttcaggaggcg
aggacgctggtggagaagctaaagactgagaagctggagctgaagaggcagaaggagaag
gctctgcaggaaagtgaaaagggtcagattcccggtgagacagaaagagaggcttggagg
atcctgaaagagcagctcgaggaccgtttgcaacacctggaagagaccagtgaaggcctc
cagaaggagaaacaagcccttcttctggagaaccaggagctcaggacaaagaccgagatc
caaccacagagactgccagagaccgaatctctgcaagaggcgagtgacaggagtgtagat
tccaatgacctgctgacgaaggtgcaggatgtggagaacgagaacacggtgctcaaggag
gagctggcatccctgcggggcaagatggcccacttggcagtaagggaaaaacaagtggag
aggcgggccgagcagcagttacaggccctgaagaggcaggtggagcaactgacggaagac
aaagggtctgtgaaagcccaggtgacctcactgctcggggaactacaggagagccagagc
cgcctggagctctcgaacaaagacaaacaagtcctcgaggacagagctcgaactgtcacg
gagaagcttaagcagctggagagtgagaacgagcagctgcacaagcaacacagcgttcag
gtggaccagctgcgcatgcagacccaaaatgtggaggccgccttgcgcatggagcggcag
gctgcctctgaggagaagcggaagctggcccagttgcaggtagcctaccaccagctcttt
caggagtatgacaaccatatcaagaaaagccaggccagcagtgagcgcagtaggggaatg
gacctccagttggaagacctcaatcaacagttacaacaggcagaagaggccttggtagcc
aaacaagaattgattgacaaacttaaggaggaggcggaacaacacaagacagtgatggag
acgatcccggtcctgaaggcacaggctgatatctacaaggctgacttccaggcagagagg
caagcccgagagaaactggcagagcgcaaggagctcctgcaggaccagctcgagcagctc
caaagggagtatagcaaactgagggccgactccaaagaaagtacccgtattgaagatatg
agaaaacggcatgtagagaacccgcaggcagccttgccgcagccagttcaccttgtcaat
caccaccttccctttcaccccctaccgcctggccagaggagaagccttccggatcaacag
cccgatttttgttgtcctaaatgtctgtatcaggccccagatatcgacaccctgcagata
catgtcatggaatgtattgagtga

DBGET integrated database retrieval system