KEGG   Monodelphis domestica (opossum): 100023197
Entry
100023197         CDS       T01031                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo04010  MAPK signaling pathway
mdo04014  Ras signaling pathway
mdo04015  Rap1 signaling pathway
mdo04151  PI3K-Akt signaling pathway
mdo04390  Hippo signaling pathway
mdo04810  Regulation of actin cytoskeleton
mdo05200  Pathways in cancer
mdo05218  Melanoma
mdo05224  Breast cancer
mdo05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100023197 (FGF1)
   04014 Ras signaling pathway
    100023197 (FGF1)
   04015 Rap1 signaling pathway
    100023197 (FGF1)
   04390 Hippo signaling pathway
    100023197 (FGF1)
   04151 PI3K-Akt signaling pathway
    100023197 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100023197 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100023197 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    100023197 (FGF1)
   05218 Melanoma
    100023197 (FGF1)
   05224 Breast cancer
    100023197 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mdo04052]
    100023197 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:mdo00536]
    100023197 (FGF1)
Cytokines and growth factors [BR:mdo04052]
 Growth factors
  Growth factors (RTK binding)
   100023197 (FGF1)
Glycosaminoglycan binding proteins [BR:mdo00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100023197 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 100023197
NCBI-ProteinID: XP_001368921
Ensembl: ENSMODG00000029105
LinkDB
Position
1
AA seq 155 aa
MAEGEITTFTALTERFNLPLGNYKKPKLLYCSNGGHFLRILPDGKVDGTRDRNDQHIQLQ
LSTESVGEVYIKSTESGQYLAMDTDGLLYGSQTPSEECLFLERLEENHYNTYTSKKHAEK
NWFVGLKKNGSCKKGPRTHYGQKAILFLPLPVSSE
NT seq 468 nt   +upstreamnt  +downstreamnt
atggccgaaggggagatcacaaccttcacagccctgactgaaagatttaacctgccactg
gggaattacaagaaacccaagcttctctactgtagcaatgggggccatttcttgaggatc
cttcctgatggcaaagtggatgggacacgggacagaaatgatcaacacattcaactgcag
ctgagcacggaaagtgtgggtgaggtgtatataaagagcactgagtctggccagtatttg
gctatggacaccgatggacttttatatggctcacagacacccagtgaagaatgcttgttt
ctggagaggttggaggagaatcattacaacacctacacatcgaagaagcatgcagagaaa
aattggtttgttggtctcaagaagaatggaagctgcaaaaagggtcccaggactcactac
ggccagaaagccatcctgttccttcccctccctgtgtcctctgagtaa

DBGET integrated database retrieval system