KEGG   Monodelphis domestica (opossum): 100023254
Entry
100023254         CDS       T01031                                 

Gene name
NR3C1
Definition
(RefSeq) nuclear receptor subfamily 3 group C member 1
  KO
K05771  glucocorticoid receptor
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100023254 (NR3C1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mdo03000]
    100023254 (NR3C1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mdo03310]
    100023254 (NR3C1)
Transcription factors [BR:mdo03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    100023254 (NR3C1)
Nuclear receptors [BR:mdo03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   100023254 (NR3C1)
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 100023254
NCBI-ProteinID: XP_001368983
Ensembl: ENSMODG00000010319
UniProt: F6S9Z9
LinkDB
Position
1
AA seq 777 aa
MDTKESLSPSCGEETTKSIHGRSRGNVMDFYKTIRGGAAVKIPVSSPSLAAASQSDSKQQ
QQQQQPILGDFSKGTAGSAQQPDLSKAVSLSMGLYMGDTDSKVMGNDLVFPQQGQIGVSS
GETDFRLLEESIASLNKSARVPQSPKSSTSSATDNEFPTKSNCDKALEKPTFKKGSAGTK
DGNAKLYTEDQSTFDILQDLELSAGSPGKETNESPWRLDPLLDENCLLSPLATDDPFLLE
GNADEDCKPLILPDTKPKITEQGGLILPSSNMPLPQVKTEKEDFIELCTPGVIKQEKLGP
VYCQGSFSGANIIGNKMSAISVHGVSTSGGQMYHYDLNTASLSQQQDHKPVFNVIPPIPV
GSENWNRCQGSGDDNLTSLGTLNFTSRSVFSNGFSSPGMRPDVSSSPSSSSTTTGPPPKL
CLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRK
CLQAGMNLEARKTKKKIKGIQQTNPAATRETSESPVNKTMVPASLPQLTPTLVSLLEVIE
PEVLYSGYDSTMPDTTWRIMSTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSW
MFLMSFALGWRSYKQSSGNLLCFAPDLVMNEQRMNLPCMYDQCKHMLLVSSELQRLQVSY
EEYLCMKTLLLLSSVPKEGLKSQSLFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTK
LLDSMHEIVESLLNYCFQTFLDKTMSIEFPEMLAEIISNQIPKYSNGNIKKLLFHQK
NT seq 2334 nt   +upstreamnt  +downstreamnt
atggacacaaaagaatcgttaagtccctcgtgtggagaagaaaccaccaagagtatacat
ggtcggagcagaggaaatgtaatggacttttataaaacgataaggggtggagctgctgtg
aaaattcctgtatcttcaccgtcactggctgctgcttctcagtcagactctaagcaacag
caacagcagcagcagcctattttgggtgacttttctaaaggcacagcaggcagcgcacag
cagccagatctatctaaagcagtctcactatcaatgggactctatatgggtgacacagat
tcaaaagtaatgggaaatgatctggtattccctcaacagggccaaattggtgtttcttct
ggtgaaacagattttaggcttcttgaagagagcatcgcaagcctcaataagtcagccagg
gtgcctcaaagccccaagagttcaacatcttctgccacagacaatgaatttccaacaaaa
tctaattgtgataaagctttagaaaagccgacttttaaaaagggctcggctggcactaaa
gatggcaatgcaaaattgtatactgaagaccaaagtacctttgacattttgcaggatttg
gaattgtctgctgggtctccaggtaaagagacaaatgaaagtccttggagattagacccc
ttgttagatgaaaactgtttgctttctcctttggcaacagatgatccatttctattagaa
ggtaatgcagatgaagactgcaagcctcttattttgccggacactaagcctaaaattact
gagcaggggggcctaattttacccagttctaatatgccattacctcaagtgaaaacagaa
aaggaagattttattgaactttgtactcctggcgtaattaaacaggagaaactgggccca
gtttactgtcaaggaagtttttctggggcaaatataattggtaacaagatgtctgccatt
tctgttcatggtgtgagtacctctgggggacagatgtaccattacgacttgaatactgca
tccctttctcagcagcaagatcacaagcctgtgtttaatgtcattccacccattcctgtt
ggttcagaaaattggaataggtgccagggatctggagatgacaacttgacttccttggga
actctgaatttcaccagtcgatctgttttttcaaatggattttcgagccctggaatgaga
ccagatgtaagctcttctccatccagttcctccacgacaacgggaccaccccccaagctc
tgccttgtttgctcagatgaggcttcaggatgtcattatggagttctaacttgtggaagt
tgtaaagtcttcttcaaaagagcagtggaagggcagcacaattatctttgtgctggaaga
aatgattgtatcattgataaaattcgaagaaaaaactgcccagcatgtcgttaccgaaaa
tgtctccaagctggaatgaacctagaagctcgaaagacaaagaagaaaattaaaggaatt
cagcaaaccaatccagcagcaacaagagagacttctgaaagtcctgtcaacaaaactatg
gttcctgcatcactgccacagcttaccccaactctggtgtcactcctggaggtcattgag
ccagaggtgttatattcaggatacgacagtacaatgcctgataccacttggaggatcatg
tcaacgcttaacatgttaggagggcggcaagtgattgcagctgtgaaatgggcaaaggca
attccaggttttagaaatttgcacctggatgaccaaatgaccctgctgcaatactcctgg
atgttcctgatgtcatttgcactaggatggagatcatacaagcaatcaagtggaaacctg
ctgtgttttgctcctgacctggtcatgaatgagcagaggatgaatttaccatgcatgtat
gaccaatgtaaacatatgctacttgtgtccagtgaattacaacgacttcaggtttcttat
gaagaatatctctgcatgaaaaccttattacttctctcttcagttcccaaggaaggcttg
aaaagccagtccctctttgatgagatcagaatgacttacatcaaggagctggggaaagcc
atagtcaagagagaaggaaactcaagtcaaaactggcagcgattctatcagctgactaaa
cttctggactctatgcatgagatagttgaaagccttctgaactattgcttccaaacattt
ttggacaagaccatgagcattgaattcccagagatgttagctgaaatcatcagcaatcag
ataccaaaatactcaaatggaaatatcaaaaaattgctctttcatcagaagtga

DBGET integrated database retrieval system