KEGG   Monodelphis domestica (opossum): 100024057Help
Entry
100024057         CDS       T01031                                 

Gene name
BRAF
Definition
(RefSeq) B-Raf proto-oncogene, serine/threonine kinase
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo01521  EGFR tyrosine kinase inhibitor resistance
mdo01522  Endocrine resistance
mdo04010  MAPK signaling pathway
mdo04012  ErbB signaling pathway
mdo04015  Rap1 signaling pathway
mdo04024  cAMP signaling pathway
mdo04062  Chemokine signaling pathway
mdo04068  FoxO signaling pathway
mdo04150  mTOR signaling pathway
mdo04270  Vascular smooth muscle contraction
mdo04510  Focal adhesion
mdo04650  Natural killer cell mediated cytotoxicity
mdo04720  Long-term potentiation
mdo04722  Neurotrophin signaling pathway
mdo04726  Serotonergic synapse
mdo04730  Long-term depression
mdo04810  Regulation of actin cytoskeleton
mdo04910  Insulin signaling pathway
mdo04914  Progesterone-mediated oocyte maturation
mdo04928  Parathyroid hormone synthesis, secretion and action
mdo04934  Cushing syndrome
mdo05034  Alcoholism
mdo05160  Hepatitis C
mdo05161  Hepatitis B
mdo05200  Pathways in cancer
mdo05205  Proteoglycans in cancer
mdo05210  Colorectal cancer
mdo05211  Renal cell carcinoma
mdo05212  Pancreatic cancer
mdo05213  Endometrial cancer
mdo05214  Glioma
mdo05215  Prostate cancer
mdo05216  Thyroid cancer
mdo05218  Melanoma
mdo05219  Bladder cancer
mdo05220  Chronic myeloid leukemia
mdo05221  Acute myeloid leukemia
mdo05223  Non-small cell lung cancer
mdo05224  Breast cancer
mdo05225  Hepatocellular carcinoma
mdo05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100024057 (BRAF)
   04010 MAPK signaling pathway
    100024057 (BRAF)
   04012 ErbB signaling pathway
    100024057 (BRAF)
   04068 FoxO signaling pathway
    100024057 (BRAF)
   04024 cAMP signaling pathway
    100024057 (BRAF)
   04150 mTOR signaling pathway
    100024057 (BRAF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100024057 (BRAF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100024057 (BRAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100024057 (BRAF)
   04062 Chemokine signaling pathway
    100024057 (BRAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100024057 (BRAF)
   04914 Progesterone-mediated oocyte maturation
    100024057 (BRAF)
   04928 Parathyroid hormone synthesis, secretion and action
    100024057 (BRAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100024057 (BRAF)
  09156 Nervous system
   04726 Serotonergic synapse
    100024057 (BRAF)
   04720 Long-term potentiation
    100024057 (BRAF)
   04730 Long-term depression
    100024057 (BRAF)
   04722 Neurotrophin signaling pathway
    100024057 (BRAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100024057 (BRAF)
   05205 Proteoglycans in cancer
    100024057 (BRAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100024057 (BRAF)
   05212 Pancreatic cancer
    100024057 (BRAF)
   05225 Hepatocellular carcinoma
    100024057 (BRAF)
   05226 Gastric cancer
    100024057 (BRAF)
   05214 Glioma
    100024057 (BRAF)
   05216 Thyroid cancer
    100024057 (BRAF)
   05221 Acute myeloid leukemia
    100024057 (BRAF)
   05220 Chronic myeloid leukemia
    100024057 (BRAF)
   05218 Melanoma
    100024057 (BRAF)
   05211 Renal cell carcinoma
    100024057 (BRAF)
   05219 Bladder cancer
    100024057 (BRAF)
   05215 Prostate cancer
    100024057 (BRAF)
   05213 Endometrial cancer
    100024057 (BRAF)
   05224 Breast cancer
    100024057 (BRAF)
   05223 Non-small cell lung cancer
    100024057 (BRAF)
  09165 Substance dependence
   05034 Alcoholism
    100024057 (BRAF)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100024057 (BRAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100024057 (BRAF)
   05160 Hepatitis C
    100024057 (BRAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100024057 (BRAF)
   01522 Endocrine resistance
    100024057 (BRAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mdo01001]
    100024057 (BRAF)
Enzymes [BR:mdo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100024057 (BRAF)
Protein kinases [BR:mdo01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   100024057 (BRAF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase RBD C1_1 zf-RING-like Kinase-like C1_2
Motif
Other DBs
NCBI-GeneID: 100024057
NCBI-ProteinID: XP_007504512
Ensembl: ENSMODG00000013637
LinkDB All DBs
Position
8
AA seq 787 aa AA seqDB search
MAALSGGGGGGGGAEQGPILFNGDMDPEAGAGSASSAEPAIPEEVWNIKQMIKLTQEHIE
ALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESMGNGTDFSVSSSASTDTVTS
SSSSSLSVAPSSLAVFQNPTDVSRSNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDSLK
KALMMRGLIPECCAVYRRQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRKTF
FTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVSKFFEHHPIPQ
EEASLGETTLTSGSSPSAPPSDSIGPPVLTSPSPSKSIPIPQPFRPADEDHRNQFGQRDR
SSSAPNVHINTIEPVNIDDLIRDQGLRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGP
QRERKSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAV
KMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLH
IIETKFEMIKLIDIARQTAQGMELEVVKQIEDGKFAMQEKDFICLVGLKCRCCSSFTYYT
SDIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDV
YAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKK
KRDERPLFPQILASIELLARSLPKIHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGG
YGAFPVH
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgctgagcggcggcggcggtggcggaggcggcgcagagcagggccccattctc
ttcaacggggatatggatcccgaggctggcgccggctcggcctcctccgctgagccggcc
atccccgaggaggtgtggaatatcaaacaaatgattaaattaacacaggaacacatagag
gccctattggacaaatttggaggggaacataatccaccatcaatctatctggaggcctat
gaagaatacaccagcaagctagatgcacttcaacaacgtgaacaacaattattagagtcc
atggggaatggaactgatttttctgtttctagctcagcttcaacagacacagttacatca
tcttcctcttctagcctttcagtggcaccttcatctcttgcagtttttcagaatcccaca
gatgtgtcaagaagcaaccctaagtcaccacagaaaccaattgttagagtcttcctcccc
aacaaacagaggactgtggtaccagcaagatgtggagtgacagtccgagatagtctaaag
aaggcattgatgatgagaggcctgatcccagaatgttgtgctgtgtacagaagacaggat
ggagagaagaagcctattggctgggacactgatatttcctggcttactggagaagaactg
catgtagaagttttggagaatgttcccctaacgacacacaattttgtacggaagacattt
ttcactttagcattctgtgacttttgtcgaaagctgcttttccaaggtttccgctgtcag
acatgcggttacaaatttcaccaacgctgtagcacagaggttccattgatgtgtgttaat
tatgatcagcttgatttgctgtttgtctccaagttctttgaacaccacccaataccgcag
gaggaggcctccttaggagagaccacccttacgtcgggatcatccccttcagcacccccc
tcagattctattgggcctccagttcttaccagtccatcgccttcaaaatccattccaatc
ccacagccctttcgaccagcagatgaagatcatcggaaccaatttggacaacgtgaccgg
tcttcgtcagctcccaatgtgcatataaacacaatagagcctgtcaatattgatgacttg
attagagaccaagggttacggggtgatggagggtcaaccacaggcttgtctgccacccct
cctgcttccttgcctggatctctaactaatgtgaaagcattacagaaatctccaggacct
cagcgtgagagaaaatcttcatcatcttctgaagacaggaatagaatgaaaacccttggt
cgacgggactcaagtgatgattgggagattccagatggtcagatcacagttggacaaagg
ataggatcaggatcatttggaacagtctataaggggaaatggcatggtgatgtagctgtg
aaaatgttgaatgtgacagcacccacacctcagcagttacaggccttcaaaaatgaagta
ggagtgctcaggaaaacacgacatgttaatatcctactctttatgggttattcaacaaaa
ccacagctagccattgtgacacagtggtgtgaaggctccagtttatatcaccatctacat
atcattgagaccaaatttgagatgatcaaactaatagatattgcacggcaaacagcacaa
ggcatggaattagaagtagtgaagcagattgaggatggcaagtttgctatgcaagagaag
gatttcatatgtttggtgggtttaaaatgtagatgttgttcttcttttacttactacacc
tcagatatatttcttcatgaagacctcacagtaaaaataggagattttggtctggctaca
gtgaaatctcggtggagtggctcccatcagtttgaacagttgtctggatccatcttatgg
atggcaccagaggtcattagaatgcaagataaaaacccatatagctttcaatcagatgta
tatgcatttgggattgttctgtatgagttgatgactggacagttaccttactcaaacatc
aacaacagggaccagataatttttatggtggggcgaggatacctgtctccagatctcagc
aaggtgcggagtaactgtccaaaagccatgaaacggttaatggcagagtgcctgaagaag
aagagggatgagaggccactttttccgcagattcttgcctccattgaacttctggcccgc
tcattgccaaaaattcaccgcagtgcatctgaaccctcattgaatcgggctggcttccaa
acggaggattttagtctgtatgcttgtgcttctccaaaaacgcccatccaggcaggggga
tatggtgcgtttcctgttcactga

DBGET integrated database retrieval system