KEGG   Monodelphis domestica (opossum): 100024271
Entry
100024271         CDS       T01031                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase 2
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00220  Arginine biosynthesis
mdo00330  Arginine and proline metabolism
mdo01100  Metabolic pathways
mdo04020  Calcium signaling pathway
mdo04066  HIF-1 signaling pathway
mdo04146  Peroxisome
mdo04371  Apelin signaling pathway
mdo04926  Relaxin signaling pathway
mdo05010  Alzheimer disease
mdo05014  Amyotrophic lateral sclerosis
mdo05022  Pathways of neurodegeneration - multiple diseases
mdo05133  Pertussis
mdo05140  Leishmaniasis
mdo05142  Chagas disease
mdo05145  Toxoplasmosis
mdo05146  Amoebiasis
mdo05152  Tuberculosis
mdo05200  Pathways in cancer
mdo05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    100024271 (NOS2)
   00330 Arginine and proline metabolism
    100024271 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100024271 (NOS2)
   04066 HIF-1 signaling pathway
    100024271 (NOS2)
   04020 Calcium signaling pathway
    100024271 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100024271 (NOS2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100024271 (NOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100024271 (NOS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100024271 (NOS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100024271 (NOS2)
   05014 Amyotrophic lateral sclerosis
    100024271 (NOS2)
   05022 Pathways of neurodegeneration - multiple diseases
    100024271 (NOS2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100024271 (NOS2)
   05152 Tuberculosis
    100024271 (NOS2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100024271 (NOS2)
   05145 Toxoplasmosis
    100024271 (NOS2)
   05140 Leishmaniasis
    100024271 (NOS2)
   05142 Chagas disease
    100024271 (NOS2)
Enzymes [BR:mdo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     100024271 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 NAD_binding_6
Other DBs
NCBI-GeneID: 100024271
NCBI-ProteinID: XP_016285135
Ensembl: ENSMODG00000019228
LinkDB
Position
2
AA seq 1063 aa
MACPWKFLFRAKSSQYIFEEEKDINNNMGKPSINSIGPLTEDDVKPHGLSKPWNEQQQPP
VVEAKKSPEPQVNGIHPPSGCPRHVRIKNWGNGMTFQDTLHHKAALAIDCQSKACRGSIM
TPKSMTRGTRDRPIPAGELLPQAIDFVNQYYGSFKEAKIEQHLARVEAVTKEIETTGTYQ
LTEDELIYATKQAWRNAPRCIGRIQWSNLQVFDARNCTTAKEMFEHICQHIRYATNNGNI
RSAITLFPQRSDGKHDFRVWNAQLLRYAGYQMPDGSIIGDPASIEFTQLCIDLGWVPKYG
RFDILPLVLQANGQDPEIFEIPKDFVLEVPIEHPKYEWFKELDLKWYALPAVANMLLEVG
GLEFPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHKLASLWKDRAVIEINV
AVLHSFQKQNVTIMDHHSAAESFMKYMQNEYKSRGGCPADWVWLVPPISGSITPVFHQEM
LNYVLSPFYYYQVEAWKTHVWHDEKKRPKKREIKLKVLVKAVFFVSVLMRKTMAARIKVT
VLFATETGKSETLARDLGDLFSCAFNTKVLCMDEYKLNNLEKEKLLLVVTSTFGNGDSPG
NGEKLKKSLFLLKELKNKFRYAIFGLGSSMYPQFCAFAHDIDQKFLQLGASQLTPTGEGD
ELSGQDEAYRSWALNNFKVACETFNIKARDTIQIPKSYTTNETWTPENYRLVQDSQPLDL
NKALSNMHAKNVFSMKLKSRQNLQSLKSSRATLLIKLYAEGNQNLNYAPGEHLGVFPGNQ
PTLVQGIMERVKDGPSPHQSFRLEIRDENGDYWISDKKLPPCSLHQALTYFLDITTPPTQ
LLLRKLAQLTTSEEEKKRLEALCQTSEYNKWKFTNSPTFLEVLEEFPSIQISATFLLSQL
PLLKPRYYSISSSQDLHPKEIHLTVAVVTYQTRDGQGPVHHGVCSTWLSDLKLQETVPCF
VRSASGFQLPENPSHPCILVGPGTGIAPFRSFWQQRLVDREKKGSKTASMMLVFGCRHPD
MDHLYREEMKEMTQKGVLRDVYTAYSRQPGQSKISEPMDQHPH
NT seq 3192 nt   +upstreamnt  +downstreamnt
atggcctgtccctggaagttcttgttcagagccaaaagctctcaatacatctttgaagag
gagaaagatatcaataacaacatgggaaaacccagcatcaattccatcggtccattgaca
gaggatgatgttaaacctcatggcctgagcaagccttggaatgagcagcaacaaccacca
gtggtggaggcaaagaagtcccctgagccccaggtcaatgggatccatcccccatcaggc
tgtccaaggcacgtgcggattaaaaattggggcaatggaatgacattccaagatactctc
caccacaaagctgcattggctatcgattgccagtccaaggcttgcagagggtcgatcatg
acacccaagagcatgactagaggcactagagacagaccaatcccagcaggagagctccta
cctcaagccattgactttgtcaaccagtattatggctccttcaaagaggcaaaaatagag
caacatttggccagagtggaagcagtaacaaaggagatagaaacaacaggaacttaccag
ctaacggaagatgagctcatttatgcaaccaagcaggcctggagaaatgcccctcgatgc
attgggaggatccagtggtccaacctgcaggtatttgatgctcggaactgcacaacagcc
aaagagatgttcgaacacatctgtcagcacatccgctatgcaaccaacaacggaaacatc
aggtccgccattactctgttcccccagaggagtgatgggaaacatgacttccgggtctgg
aatgctcagctcctgcgatatgcgggctatcagatgccagatggctccatcataggtgat
cctgccagcattgaattcacccagctgtgtatagacttgggatgggtgcccaaatatggc
cgctttgatatcttgcctctcgtgttacaagccaatggccaggacccagagatctttgag
attccaaaagacttcgtccttgaggtgcctatagaacatcccaaatatgagtggttcaag
gagctggatctgaagtggtatgctttgcctgctgtggccaacatgctcctcgaagtgggt
ggcctagagttccctgggtgcccattcaatggctggtatatggggactgagattggtgtc
cgagacttctgtgacgtccagaggtacaacatcctggaggaagttgggaggaggatgggt
ctagaaacccacaagttggcctccctctggaaggacagggcagtgatcgagatcaacgtg
gctgtgctccatagtttccaaaaacaaaacgtcaccatcatggatcaccactccgcagca
gagtccttcatgaaatacatgcagaatgaatacaagtctcgaggcggctgccctgcagat
tgggtctggctggttcctccaatctccgggagcatcaccccagtgtttcatcaggagatg
ctaaactatgttctttctcctttctattactaccaggtggaggcctggaaaactcatgtc
tggcatgatgagaagaagaggcccaagaaaagagagatcaaattaaaggtcttggtcaaa
gcagtgttctttgtctctgtcctgatgcgcaagaccatggcagcccggatcaaagtcaca
gtgctctttgccacagaaacaggcaaatcagaaactctggccagggatctgggagacttg
ttcagctgtgctttcaataccaaggttctctgcatggacgagtacaaactgaacaaccta
gaaaaagagaagctacttctggtggtgaccagcacctttggaaatggagattctcctggg
aatggggagaaattgaagaagtccctgtttctcctcaaggagctaaaaaataaattcaga
tatgctatatttggccttggctccagcatgtaccctcagttctgtgccttcgcccatgac
atcgaccaaaagtttttgcagctgggggcctctcagcttacaccaactggagaaggagat
gaactcagtggacaagatgaggcctatcgcagctgggcactgaataacttcaaggtggcc
tgtgagaccttcaacatcaaagccagggacacaattcagatccccaaatcgtataccacc
aatgaaacctggaccccggaaaattaccgccttgtgcaggattcccagcccctggacctc
aacaaagccctcagcaacatgcatgccaagaatgtgttttccatgaagctcaaatcaaga
cagaatctgcagagtctcaaatccagccgggcaaccctcctcattaaactttacgctgaa
ggaaaccagaatttgaattatgcaccaggagagcatcttggggtttttcctggcaaccag
cccaccctagttcagggtattatggagcgagtaaaggacggcccatcacctcaccagtcc
ttccgcctagaaatccgggatgaaaatggtgactactggatcagcgataagaagcttccc
ccctgctccctccaccaggccctgacgtatttcctggatatcaccacccccccaacccag
ctgcttctccgaaagttggctcagctgaccacttcagaggaagagaagaagaggctggag
gctctgtgccagacctcagaatacaataaatggaagttcaccaacagccccacattcctg
gaggtgctggaagagtttccctccatccagatttcagccacttttctgctctcacaattg
cctctgcttaaaccccgctactattccataagctcatctcaggacctccaccccaaggaa
atccacttgactgtggctgtggtcacttaccagaccagagatggtcagggccccgtccac
catggagtctgcagcacatggctcagtgacctgaagctccaagagaccgtgccctgcttt
gtgcgcagtgccagtggcttccagctgccagagaaccccagccacccatgcatcctggta
gggccaggtactgggatagcccccttcaggagtttctggcaacagcgcctggtggacaga
gagaagaaaggcagcaagaccgccagcatgatgttggtgtttggatgccgacaccctgac
atggatcacctgtatcgagaggagatgaaagagatgacacagaagggagtgctccgggac
gtctacacagcctactcccgccagccgggccagtccaagatctctgagccaatggaccag
catccccactaa

DBGET integrated database retrieval system