KEGG   Monodelphis domestica (opossum): 100024319Help
Entry
100024319         CDS       T01031                                 

Definition
(RefSeq) glutamate decarboxylase 1-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00250  Alanine, aspartate and glutamate metabolism
mdo00410  beta-Alanine metabolism
mdo00430  Taurine and hypotaurine metabolism
mdo00650  Butanoate metabolism
mdo01100  Metabolic pathways
mdo04727  GABAergic synapse
mdo04940  Type I diabetes mellitus
Module
mdo_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    100024319
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100024319
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100024319
   00430 Taurine and hypotaurine metabolism
    100024319
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    100024319
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    100024319
Enzymes [BR:mdo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     100024319
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-GeneID: 100024319
NCBI-ProteinID: XP_007486906
Ensembl: ENSMODG00000004841
LinkDB All DBs
Position
3
AA seq 577 aa AA seqDB search
MDFREHGFVSQPDVKPKKISCLSKNVTQYHISLRNVSTGSKGVELHGVQRRKKSICDVQG
CEEDMGKEDNIESFMTDFSNVYASDLLPSKHGGEFTEQFLLEVVDILLHYIRKTFDEKSK
ILDFHYPHQLLEGLDGFNLELSDQPEPLEQLLVDCRDTLKYGVKTGHPRFFNQLSSGLDI
IGVAGEWLTATANTNMFTYEISPVFIVMEMILLKKMHEIIGWGETEADGIFSPGGSISNL
YSILVARYKKFPEIKTKGMAVLPHIVLFVSEHSHYSIKKIAAVLGIGTDNVIEVKCDERG
KMIPLELEKNILQAKKMGLTPFCVSATAGTTVYGAFDPLDNIADICEQHNLWMHVDAAWG
GGLLMSKKHSYKLHGIERADSVTWNPHKLMGVPLQCSVVLIREMGLLKSCNQMCAEYLFQ
PDKHYDIGYDTGDKTIQCGRHVDIFKLWLMWKAKGTYGFEVQINKFMELADYLYKILKKK
ENFELVFDAEPELTNVCFWYIPPRLKSISNEYERQQELQKIAPKIKAMMIEGGTTMISYQ
PHGDKVNFFRMVFSNPATKQSDVDFLIDEIERLGKAL
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atggattttagagaacatggatttgttagtcagcccgatgtgaaaccaaagaaaatcagt
tgtctatccaaaaacgttactcagtaccacataagcctgagaaatgtatcaacagggtca
aaaggtgtggagctgcatggagtgcagaggagaaaaaaatctatttgtgatgtccaaggt
tgtgaagaagacatgggaaaagaagataatattgagagtttcatgactgatttttcaaat
gtttatgcctcagatttattaccatctaaacatggaggtgaattcacagaacaatttctg
ctagaagtggttgacattctcttgcattatatcagaaaaacctttgatgagaaaagtaaa
atattggatttccattaccctcatcaactccttgaaggtttggatgggttcaacttagaa
ctgtctgaccagcccgaaccactggaacagctgcttgttgattgcagagatacattaaaa
tatggagttaaaacaggacatcctcgcttttttaaccagctctctagtgggcttgatata
attggggtagctggggagtggttgacagctactgcaaatactaacatgtttacatatgaa
atatcccctgtgtttattgtcatggaaatgatactcctgaagaaaatgcatgaaataatt
ggctggggagaaacagaagctgatggaatattttctcctggtgggagcatatcaaatctc
tatagcatattggtagctcgttacaagaaatttcctgagattaaaaccaaaggcatggct
gtgcttccacatattgtattatttgtttctgaacatagtcattattccataaagaaaata
gcagcagtacttggcattggaactgataatgtaattgaggtaaaatgtgatgaaaggggg
aagatgattcctttagaattagagaaaaatatactacaagccaagaaaatgggacttact
cccttttgtgtcagtgccacagcaggtacaacagtatatggtgccttcgatcctctggac
aacattgctgatatttgtgagcagcacaacctctggatgcatgtggatgcagcatgggga
ggtggattattgatgtccaaaaaacattcttataagctccatggcattgaaagggccgac
tctgtgacctggaatccccacaaactgatgggtgtccctcttcagtgttcagttgtcctc
attcgagaaatgggtcttcttaaatcatgtaaccagatgtgcgctgagtatctattccag
cctgataaacactacgatataggctatgacactggggacaagacaattcagtgtggccgg
catgttgatatcttcaaactctggttaatgtggaaagcaaagggcacctatggctttgaa
gttcagataaataaatttatggagttggcagattatctttacaagatcctgaagaaaaaa
gaaaattttgagcttgtatttgatgcagaacctgaactcactaatgtttgtttctggtat
atcccaccaagacttaaaagcatttcaaatgaatatgaaagacaacaagaacttcaaaag
attgcaccaaagattaaggcaatgatgatagaaggtggcacaactatgatcagctaccag
ccacatggagacaaagtcaatttttttcgaatggtcttctctaaccctgctaccaaacaa
tcagatgttgattttcttattgatgaaattgaaaggcttgggaaagctctatga

DBGET integrated database retrieval system