KEGG   Monodelphis domestica (opossum): 100024662Help
Entry
100024662         CDS       T01031                                 

Gene name
POLRMT
Definition
(RefSeq) RNA polymerase mitochondrial
  KO
K10908  DNA-directed RNA polymerase, mitochondrial [EC:2.7.7.6]
Organism
mdo  Monodelphis domestica (opossum)
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mdo03029]
    100024662 (POLRMT)
Enzymes [BR:mdo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     100024662 (POLRMT)
Mitochondrial biogenesis [BR:mdo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial RNA polymerase
    100024662 (POLRMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNA_pol RPOL_N PPR_3 PPR_2 PPR
Motif
Other DBs
NCBI-GeneID: 100024662
NCBI-ProteinID: XP_016288173
Ensembl: ENSMODG00000006478
LinkDB All DBs
Position
3
AA seq 1234 aa AA seqDB search
MSVLRLRASLLRRGAARLGRALRTEDCPCSGPEKGTSWTWGRMYSVNAPEQDRRRDAGQV
ELLEVLEARVRQLQTENVSEVTINHVEVTPLRTSNQKDLQALGLMEDGAKQDASNSAQMV
HKVQTWWVEKLNQEKSDLNKRQKDLEVKLKNQDFWESQLKKREKAFVARKLKPKPSKPKP
SPCTKKAKREEQTPPPKMRQVKKDLEQKSSSAINLNSFKQVPEKVVRPSRKQVFILACLE
CFISLDQLAQANNLLLSYFNRRLGQKHLTLPMYNSLLKAWAKKGSLHQISTLFSMMNESG
LNPDLVSYAAALECMGRMDADFNLIKRCLNQMAQEGLKVENLFHHLALHQQKKMIILKAI
QKVEPEFSPPLLLPSSSHNITQSPLLRDFYSKEEPVSYPKLSLPLLELQERFQQQLNLES
AMTITIDSVEKKPLIKKNFHAVSLYSPAASVLRYNVLSRTFHLVNLIYSAFVPSPSSVQA
LFNLPPHGDSLVHLVMDLGMKVYNKNLIQMNMKSFVLDELKKKYMNYLHLLAKDTQLDSC
LPREHWETLESEGTSCSNFLTQEKVWPDVLLVRLGTQLIEILVQSIYMPNSLSPSQATKR
FIPVLYHVYSFLSIKQIGFIKPHPSFIQLVDEAAYTTLTFDVSVMPMLCPPIPWTSPNFG
AYVLHPTKLMRCLDGTVQHQQLLESCPQGQLNAVLDALTQLGNCAWKVNQPVLDLVISIF
NAKGNKKLDVPPPVSEAPTPPSYELSKGASSSEKAKLRREIAQCHKTAREMYSLRMDALY
KLSIAHHLRDQIFWFPHNMDFRGRAYPCPPHFNHLGSDMTRAILLFAEGKPLGPNGLDWL
KIHLINLTGLKKKESLQARLAYANEILEDILDSADNPLTGRKWWMDVDEPWQALACCMEI
ANAIRSPDPTAYISHFPIHQDGSCNGLQHYAALGQDVIGATSVNLMPCDVPQDVYSGVAQ
LVEELRKRDAAEGKSIAQVLEGFINRKLVKQTVMTVVYGVTKYGGRLQIEKRLKELDDFP
KEHIWEASLYLSQLVFSSLGEMFSTTREIQDWLTKSAHVISKSGSAVQWVTPLGLPIIQP
YHKTQKMTIPGNLQSLCLSSCSDVNQKPNTLKQKNAFPPNFIHSLDSTHMMLTALSCHRK
GLTFVSVHDCFWTHASTVDIMNEVCREQFVNLHSQPILQDLSKFLVTKYCPWSWSHESEE
MSDNQKLMLMILSDVPKLGNLDLQKVKESTYFFS
NT seq 3705 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgcttcggctgagggcatcgctgctgaggcggggggcagcgaggctcggccgg
gccctccggaccgaggactgcccctgctctggtcccgagaaagggacttcatggacatgg
ggcagaatgtactctgtcaatgccccagagcaggacaggaggagggatgcggggcaagtg
gaactattggaagtgcttgaggcccgagtaagacaactccagactgagaacgtgtctgaa
gtgacaataaatcatgtggaagtgacccccctgaggacaagtaaccagaaggacttgcag
gcccttggactgatggaggatggagccaagcaagatgccagcaattctgcccagatggtg
cataaggtccaaacctggtgggtggagaaactcaatcaggaaaagagtgacttgaacaag
agacagaaggacctggaagtcaagctgaagaaccaggacttttgggaatcccagctaaag
aagagagaaaaggcatttgttgccagaaaactgaaaccaaaaccttccaaaccaaagccc
tctccttgtacaaagaaagccaaaagagaggagcagaccccacctcccaaaatgagacag
gtcaagaaagatctggagcaaaaaagcagtagtgctattaacttgaactccttcaagcag
gtgcctgagaaggtggttagaccttctagaaaacaagtcttcattttagcctgtctagaa
tgcttcatctctctggaccaactggcacaagccaataacctgcttctctcctacttcaat
cgccggctgggccagaagcatctgacactgcccatgtacaacagcctcttgaaagcttgg
gccaagaagggttccttgcatcaaataagcaccctgttttccatgatgaatgagtcaggg
ctgaatcctgacttggtatcctatgctgcagctctggagtgtatgggccgaatggatgca
gacttcaatcttatcaagagatgtctgaatcagatggctcaggagggcctgaaagtggag
aatcttttccaccatctagcactccaccagcagaagaagatgatcatactaaaagctatc
cagaaggtggaacctgaattttcaccacctctgctgctcccatcatcgtcccacaacatc
acccagtctcctctgcttagagacttctattccaaggaagagcctgtgtcttacccaaag
ctgtcactgcctctgcttgagctacaagaacgctttcagcagcagctaaacttggagtca
gccatgacaattactattgactcagtggagaagaaaccactaataaaaaagaactttcat
gcggtaagcctttattctcctgcagcctctgttctcagatacaatgtcctgtcacgtacc
tttcaccttgtgaacctgatttactctgcttttgttccctcaccctcttctgtccaggcc
ctcttcaacttgcctccacatggagattccttagtccacctagtcatggatcttgggatg
aaggtttacaacaaaaatttaatccagatgaatatgaaatcctttgtattagatgaacta
aaaaagaagtatatgaattacctacatcttttggccaaggacactcagctggactcctgc
ctgcctcgggagcactgggaaaccttggaatcagaaggtaccagctgctccaatttcctc
actcaagagaaagtctggccagatgtactattggtgcggctgggaacccaacttattgag
atcctggtgcagtccatctacatgcccaacagtttgagcccctcccaggcaacgaagaga
ttcatccccgtgctgtaccacgtttattccttcctctccataaagcagattggtttcatt
aaaccccacccatccttcattcagctggtggatgaagctgcttacactaccctgaccttc
gatgtctctgtcatgcccatgctgtgtccccccattccttggacctcgcctaactttggg
gcctatgtcctccaccccaccaagctgatgcgctgcctggacgggactgtccaacatcag
cagctgctggagagctgccctcaggggcaacttaacgcagtccttgatgccctcacccag
ctgggtaactgtgcctggaaggtgaatcagcctgtgctagacctcgttatctccatcttc
aatgctaagggcaacaagaagctggatgtgcccccgcctgtgtccgaggcccccacaccc
ccatcctacgagctctccaaaggggccagctcttcagaaaaggcaaagctgcggcgggag
atagcccagtgccataagaccgcccgggaaatgtatagcctgcgcatggatgccctgtat
aagctgtccatcgcccaccacctgcgagaccagatcttctggtttccccacaacatggac
ttccggggccgcgcctacccttgcccaccgcatttcaaccaccttggcagtgacatgacc
cgagcgatcttgctttttgctgaaggcaaacccttggggcccaatggcctggattggtta
aagattcacctcatcaacctgacaggacttaagaagaaagagtcgctgcaggcccggctg
gcctatgccaacgagatcttggaggacatcctggactcggcagacaatccactgactgga
aggaagtggtggatggatgtcgatgagccctggcaggccctagcctgctgcatggaaatt
gctaatgccatccggtcaccagatcccacagcttacatctcccatttccccatccatcag
gatggttcctgtaatgggctccagcactacgcagctctgggccaagatgtgatcggggcc
acctctgtcaacttgatgccctgcgacgttccccaggatgtatacagtggagtggctcag
ctggtagaagagctgcgtaagagagatgctgctgaagggaagtcaatagcccaagtcctg
gagggcttcatcaaccgcaagctggtgaagcagacagtcatgacggtggtctatggggtg
acaaagtacggtggcaggctgcagatcgagaagcgcctgaaggaactggatgacttcccc
aaggagcacatttgggaggcctccttgtacctctcccaactggtcttcagtagcctcggt
gagatgttctccacaaccagggaaatccaggattggctgacaaaaagtgctcacgtcatc
tccaagtccggctctgctgtgcagtgggtcacccctctgggccttcccatcattcagccg
taccacaagacccagaaaatgactattcccgggaatctgcagtctctttgcctctcgagt
tgctctgatgtcaaccagaaaccaaacaccctgaaacagaagaatgctttcccccccaac
ttcatccactctctggactccacgcacatgatgctgacggccctgtcctgtcacaggaag
ggactgacctttgtgtctgtgcatgactgcttctggacccacgcctccactgtggacatc
atgaatgaggtctgccgtgaacagtttgtgaatctgcacagtcaacccatcctgcaggac
ttatctaagttcctggtaacgaaatactgcccttggtcctggtctcacgaatctgaagaa
atgtctgacaaccagaaattgatgctgatgatactgtctgatgtgcctaaactaggaaat
ttagatcttcaaaaggtgaaggaatccacttacttcttcagctaa

DBGET integrated database retrieval system