KEGG   Monodelphis domestica (opossum): 100024802Help
Entry
100024802         CDS       T01031                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00590  Arachidonic acid metabolism
mdo01100  Metabolic pathways
mdo04064  NF-kappa B signaling pathway
mdo04370  VEGF signaling pathway
mdo04625  C-type lectin receptor signaling pathway
mdo04657  IL-17 signaling pathway
mdo04668  TNF signaling pathway
mdo04723  Retrograde endocannabinoid signaling
mdo04726  Serotonergic synapse
mdo04913  Ovarian steroidogenesis
mdo04921  Oxytocin signaling pathway
mdo04923  Regulation of lipolysis in adipocytes
mdo05140  Leishmaniasis
mdo05163  Human cytomegalovirus infection
mdo05165  Human papillomavirus infection
mdo05167  Kaposi sarcoma-associated herpesvirus infection
mdo05200  Pathways in cancer
mdo05204  Chemical carcinogenesis
mdo05206  MicroRNAs in cancer
mdo05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    100024802 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    100024802 (PTGS2)
   04064 NF-kappa B signaling pathway
    100024802 (PTGS2)
   04668 TNF signaling pathway
    100024802 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100024802 (PTGS2)
   04657 IL-17 signaling pathway
    100024802 (PTGS2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100024802 (PTGS2)
   04913 Ovarian steroidogenesis
    100024802 (PTGS2)
   04921 Oxytocin signaling pathway
    100024802 (PTGS2)
  09156 Nervous system
   04726 Serotonergic synapse
    100024802 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    100024802 (PTGS2)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    100024802 (PTGS2)
   05206 MicroRNAs in cancer
    100024802 (PTGS2)
   05204 Chemical carcinogenesis
    100024802 (PTGS2)
  09162 Cancers: Specific types
   05222 Small cell lung cancer
    100024802 (PTGS2)
  09172 Infectious diseases: Viral
   05163 Human cytomegalovirus infection
    100024802 (PTGS2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100024802 (PTGS2)
   05165 Human papillomavirus infection
    100024802 (PTGS2)
  09174 Infectious diseases: Parasitic
   05140 Leishmaniasis
    100024802 (PTGS2)
Enzymes [BR:mdo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     100024802 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF EGF_2 hEGF
Motif
Other DBs
NCBI-GeneID: 100024802
NCBI-ProteinID: XP_001375945
Ensembl: ENSMODG00000011721
UniProt: F7FSX5
LinkDB All DBs
Position
2
AA seq 608 aa AA seqDB search
MMKRISRLLLFGSIALALSQAANPCCSNPCQNRGICMTTGIDRYQCDCTRTGFYGENCTT
PEFLTKLKLMLKPTPDTVHYILTHFKGVWNIINNIPFLRDFVMRYVLISRAHLIESPPTY
NAHYGYKSWEAFSNLSYYTRALPPVGDDCPTPLGVKGKKQLPTSKEIVEKFLLRRKFIPD
PQGTNMMFAFFAQHFTHQFFKTDHHRGPEFTKGLGHGVDLNNVYGETLDRQHKLRLFKDG
KLKYQVIDGEVYPPLVKDTEVEMIYPPHIPEHLKFAVGQEVFGLVPGLMMYATIYLREHN
RVCDILKQEHPEWDDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQ
FQYQNRIAAEFNTLYHWHPLLPDTFQIKDQEYNFQQFLYNNSILLKHGVSEMVESFSKQI
AGRVAGGKNVPSAVQKVSIASIDQSRQMKYQPLNEYRKRFMLKPFSSFEELTGEKEMAAE
LEAVYGDIDAMELYPALLVEKPRPGAIFGETLVELGAPFSLKGLMGNPICSPEYWKPSTF
GGNVGFEIIKTASIQSLICNNVKGCPFTAFSVQDSQPTKTATINASSSNSGLDDINPTVL
LKERSTEL
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaaggatctcacgcctcttactcttcgggtctattgcgctagcgctcagtcaa
gcggcaaacccttgctgctcaaacccatgtcaaaaccgaggcatatgtatgaccacagga
attgaccgataccaatgtgactgtaccaggacaggattttatggagaaaattgtacaact
cctgagtttctgacaaagctaaaattgatgctgaaacccactccagacacagttcactac
atcctcacccacttcaagggagtgtggaatataattaacaatatcccctttcttcgggac
ttcgtgatgagatatgtgttgatatcaagagcacatttgattgaaagtccaccaacatat
aatgctcactatggttacaaaagttgggaagctttttctaacctctcatactacactaga
gctcttcccccagtgggagatgactgcccaactccattgggtgtaaaaggtaaaaagcag
cttccaacatccaaagagattgtggaaaaatttcttctgagaaggaagtttattcctgat
ccccaaggcacaaatatgatgtttgcattcttcgctcaacatttcactcaccagttcttt
aagacagaccatcacagaggcccagaattcactaaaggtctaggacatggggttgattta
aataatgtttatggagaaacactggatagacaacataagctgcgacttttcaaggatgga
aaattgaaataccaggtaattgatggagaagtatatcctcccttagtgaaagatactgag
gtagaaatgatctacccacctcatatccctgaacatctgaaatttgctgttggacaagaa
gtatttggcttagttccaggtttgatgatgtacgctacaatatatcttcgggaacataac
cgtgtgtgtgacatccttaaacaagaacatcctgaatgggatgatgagcagttgttccaa
actagcagactgatattgataggtgagaccattaagatcgtgattgaagattatgtccaa
cacttgagtggttaccacttcaaactgaaatttgatccagaactgctgttcaaccagcaa
tttcagtaccaaaaccgaattgctgctgagtttaacaccctttaccattggcaccctctg
ctccctgacactttccaaatcaaggaccaagaatataattttcagcagttcctctataac
aactctatattactgaaacatggagtttctgaaatggtggaatcattctccaagcaaatt
gctggccgggttgctggtggcaagaacgttccatctgcagtacagaaagtttccattgct
tccattgaccagagtagacaaatgaaataccagcctctaaatgaataccgaaagcgcttc
atgctgaaaccttttagttcatttgaagaactgacaggagagaaagaaatggctgctgag
ctggaagctgtctatggtgatatcgatgctatggagttatatcctgctcttctggtggaa
aaacctcgtccgggcgccatctttggagagaccctggtagaacttggagcgcccttctcc
ctcaaaggactcatgggtaacccaatctgctcccctgagtactggaagcctagcactttt
ggtggaaatgtaggttttgaaattatcaaaacagcctctatccagtcacttatctgcaat
aatgtgaagggatgtcccttcactgcattcagtgttcaagactcccaacccaccaaaaca
gccactatcaatgccagctcatcaaactctggactagatgacatcaaccccacagtgctg
ctaaaagaacgttcaactgaactgtaa

DBGET integrated database retrieval system