KEGG   Monodelphis domestica (opossum): 100025332
Entry
100025332         CDS       T01031                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00230  Purine metabolism
mdo01100  Metabolic pathways
mdo01522  Endocrine resistance
mdo04015  Rap1 signaling pathway
mdo04020  Calcium signaling pathway
mdo04022  cGMP-PKG signaling pathway
mdo04024  cAMP signaling pathway
mdo04062  Chemokine signaling pathway
mdo04072  Phospholipase D signaling pathway
mdo04114  Oocyte meiosis
mdo04211  Longevity regulating pathway
mdo04213  Longevity regulating pathway - multiple species
mdo04261  Adrenergic signaling in cardiomyocytes
mdo04270  Vascular smooth muscle contraction
mdo04371  Apelin signaling pathway
mdo04540  Gap junction
mdo04611  Platelet activation
mdo04713  Circadian entrainment
mdo04714  Thermogenesis
mdo04723  Retrograde endocannabinoid signaling
mdo04724  Glutamatergic synapse
mdo04725  Cholinergic synapse
mdo04727  GABAergic synapse
mdo04740  Olfactory transduction
mdo04750  Inflammatory mediator regulation of TRP channels
mdo04911  Insulin secretion
mdo04912  GnRH signaling pathway
mdo04913  Ovarian steroidogenesis
mdo04914  Progesterone-mediated oocyte maturation
mdo04915  Estrogen signaling pathway
mdo04916  Melanogenesis
mdo04918  Thyroid hormone synthesis
mdo04921  Oxytocin signaling pathway
mdo04923  Regulation of lipolysis in adipocytes
mdo04925  Aldosterone synthesis and secretion
mdo04926  Relaxin signaling pathway
mdo04927  Cortisol synthesis and secretion
mdo04928  Parathyroid hormone synthesis, secretion and action
mdo04934  Cushing syndrome
mdo04935  Growth hormone synthesis, secretion and action
mdo04962  Vasopressin-regulated water reabsorption
mdo04970  Salivary secretion
mdo04971  Gastric acid secretion
mdo04972  Pancreatic secretion
mdo04976  Bile secretion
mdo05032  Morphine addiction
mdo05163  Human cytomegalovirus infection
mdo05166  Human T-cell leukemia virus 1 infection
mdo05200  Pathways in cancer
mdo05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100025332 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100025332 (ADCY3)
   04371 Apelin signaling pathway
    100025332 (ADCY3)
   04020 Calcium signaling pathway
    100025332 (ADCY3)
   04072 Phospholipase D signaling pathway
    100025332 (ADCY3)
   04024 cAMP signaling pathway
    100025332 (ADCY3)
   04022 cGMP-PKG signaling pathway
    100025332 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100025332 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100025332 (ADCY3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100025332 (ADCY3)
   04062 Chemokine signaling pathway
    100025332 (ADCY3)
  09152 Endocrine system
   04911 Insulin secretion
    100025332 (ADCY3)
   04923 Regulation of lipolysis in adipocytes
    100025332 (ADCY3)
   04912 GnRH signaling pathway
    100025332 (ADCY3)
   04913 Ovarian steroidogenesis
    100025332 (ADCY3)
   04915 Estrogen signaling pathway
    100025332 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    100025332 (ADCY3)
   04921 Oxytocin signaling pathway
    100025332 (ADCY3)
   04926 Relaxin signaling pathway
    100025332 (ADCY3)
   04935 Growth hormone synthesis, secretion and action
    100025332 (ADCY3)
   04918 Thyroid hormone synthesis
    100025332 (ADCY3)
   04928 Parathyroid hormone synthesis, secretion and action
    100025332 (ADCY3)
   04916 Melanogenesis
    100025332 (ADCY3)
   04925 Aldosterone synthesis and secretion
    100025332 (ADCY3)
   04927 Cortisol synthesis and secretion
    100025332 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100025332 (ADCY3)
   04270 Vascular smooth muscle contraction
    100025332 (ADCY3)
  09154 Digestive system
   04970 Salivary secretion
    100025332 (ADCY3)
   04971 Gastric acid secretion
    100025332 (ADCY3)
   04972 Pancreatic secretion
    100025332 (ADCY3)
   04976 Bile secretion
    100025332 (ADCY3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100025332 (ADCY3)
  09156 Nervous system
   04724 Glutamatergic synapse
    100025332 (ADCY3)
   04727 GABAergic synapse
    100025332 (ADCY3)
   04725 Cholinergic synapse
    100025332 (ADCY3)
   04723 Retrograde endocannabinoid signaling
    100025332 (ADCY3)
  09157 Sensory system
   04740 Olfactory transduction
    100025332 (ADCY3)
   04750 Inflammatory mediator regulation of TRP channels
    100025332 (ADCY3)
  09149 Aging
   04211 Longevity regulating pathway
    100025332 (ADCY3)
   04213 Longevity regulating pathway - multiple species
    100025332 (ADCY3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100025332 (ADCY3)
   04714 Thermogenesis
    100025332 (ADCY3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100025332 (ADCY3)
  09165 Substance dependence
   05032 Morphine addiction
    100025332 (ADCY3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100025332 (ADCY3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100025332 (ADCY3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100025332 (ADCY3)
   05163 Human cytomegalovirus infection
    100025332 (ADCY3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100025332 (ADCY3)
Enzymes [BR:mdo01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100025332 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA Peptidase_S49_N NCE101
Other DBs
NCBI-GeneID: 100025332
NCBI-ProteinID: XP_007475988
Ensembl: ENSMODG00000015887
UniProt: F7B3B0
LinkDB
Position
1
AA seq 1145 aa
MPRNQGFSETEYSAEQSAEYSVSLPSDPDRAGGRTHEISVRNTGSCLCLPQFMRLTFIPE
SLENLYQTYFKRQRHETLLVLVIFAALFDCYVVIMCAVVYSSDKLAPIVVAGVGLLLDII
LFVLCKKGLLPDRVTRKVVPYLLWLLITAQIFSYLGLNFARSHAASDTVGWQAFFIFSFF
ITLPLSLTPIVLISVVSCCIHTLVLGVTVAQQQQEQLDGIGLLREILANVFIYLCAIIVG
IMSYYMADRKHRKAFLEARQSLEVKINLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVDAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFEVEPGDGGSRCD
YLDEKGIVTYLICSPKPVSPDQQQTPNGINGTATKIAPSQPSSPALINTKEPKEPNGSVT
ATSPTPEETEDLDTQVVNPSFPNPRRRLRLHDLAERVVDASEDEHELNQLLNEALLERES
AQVVKKRNTFLLSMRFMDGEMETRYSVEKEKQSGAAFSCSCVVLLCTSLVEILIDPWLMT
NYMTFVVGEILLLILTLCSMAAIFPRRFPKKLVAFSTWIDRTRWARNTWAMSAIFILILA
NVVDMLSCLQNYTGVTNGTVVTIMDGGCVDNPKYYSYIAVLALIAAIMLVQVSHMVKLTL
MLLVTVAVGVINIYAWRPIFDDYDRKRFQEHDFPPLVVTEKMQVFSTLNGTEGLPLIASK
YSMTVMVFVMMLSFYYFARHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEH
VARHFLGSKKRDEELYSQSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDF
DSLLDNPKFRIITKIKTIGSTYMAASGVTPDVNTNGFASGNKEEKSDKERWQHLADLADF
ALAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGV
MGNIQVVEETQTILKEYGFRFVRRGPIFVKGKGELLTFFLKGRDKPAPFPNGSSVTLPHQ
VVDNS
NT seq 3438 nt   +upstreamnt  +downstreamnt
atgcccaggaaccagggcttctccgagaccgagtactcggctgaacagtcggccgagtac
tcggtcagcttgccttcagatcctgatcgggcgggtggccggacccatgaaatctctgtc
cggaacacgggctcctgcctctgcctgcctcagttcatgcgtttgactttcatccctgag
tcccttgaaaatctgtatcagacttatttcaagaggcaacgccacgagaccctcctggtt
ctggtgatttttgctgccctttttgattgctatgtggtgatcatgtgcgccgtggtctat
tccagtgacaagctagcgcccattgtggtggccggggtggggctgctgctggacatcatc
ctctttgtcctctgcaagaagggcctcctcccagacagagtcaccaggaaggtggtcccc
tacctgctgtggctgctcatcaccgcccagatcttctcctacctcggcctgaactttgct
cgctcccatgcggccagtgacacggtgggctggcaggccttcttcatcttctccttcttc
atcacgctgcccctcagcctcactcccatcgtgctcatctccgtggtctcctgctgcatc
cacactctggtgctgggggtcaccgttgcccagcagcaacaggagcagttggacggcatc
gggttgctaagggagattctggctaatgttttcatctacctgtgtgccatcatcgtgggc
attatgtcctactacatggctgaccgcaagcatcgaaaggccttccttgaagcccgtcaa
tcccttgaagtgaaaatcaacttggaagaacagagccaacagcaggaaaaccttatgctt
tccatcttaccgaagcatgtggccgatgaaatgttaaaagacatgaagaaagatgaaagc
cagaaggaccagcagcagttcaacaccatgtacatgtaccgtcatgagaatgtcagcatt
ctatttgctgacatcgtgggtttcactcagctctcctcagcctgtagtgcccaggagctg
gtgaagctgctcaatgaactctttgcccgctttgacaaactggccgctaaataccaccag
ctccgtatcaagatcctgggagactgttattactgtatctgtgggctgcccgactaccgg
gaggatcatgccgtctgctccatcctcatggggctcgccatggtggatgccatttcgtac
gtgcgagagaagacaaagactggggtggatatgcgtgttggcgttcacacgggcactgtg
ctgggcggcgtgctgggccagaagcgatggcagtatgacgtgtggtccacggacgtcact
gttgccaataagatggaagccgggggcatccctgggcgtgtgcacatctcccagagcact
atggactgcctgaagggtgaatttgaagtggagccaggtgatggaggcagccgatgtgac
tacctggatgagaaaggcattgtcacctacctcatttgttctcctaaacctgtgtctcct
gatcagcagcagaccccgaatggtatcaatggcacagccaccaagatagcgccctcgcag
cccagctctcctgccctcatcaacaccaaggagcccaaggagcccaatggaagcgtcaca
gccacctccccaactcctgaggaaactgaggatctggacacccaggtggtcaacccttcc
ttccccaaccctcgacggcgcttgcgccttcacgatttggcggagagggttgtagatgcc
tctgaggatgaacatgagctcaatcagctgctcaatgaggctctgctggagagggagtcg
gcacaggtcgtaaagaagagaaacactttcctgctctccatgaggtttatggacggggag
atggaaacccgctactcggtggagaaggagaagcagagcggagctgccttcagctgctcc
tgcgtcgtgctcctttgcacgtccctggtggagatcctgatcgatccttggctgatgaca
aactacatgacctttgtggttggagagattctgctgctgattcttaccctctgctcaatg
gccgccatctttccccggcgattcccaaagaaacttgtggccttttctacctggattgac
cggacacgttgggccaggaatacttgggccatgtctgccattttcattcttatcttggcc
aatgttgtggatatgctaagctgcttacagaactacacgggagtcaccaatgggacagtc
gtgaccatcatggacgggggctgtgtggacaatcccaagtactacagctacattgccgtg
ttggccctcattgctgccatcatgctggtccaggtcagccacatggtgaagctcacgctc
atgctgctggtcaccgtggctgtgggtgtcatcaacatctatgcgtggcgtcccatcttt
gatgattacgatcgcaaacgcttccaggaacatgacttcccacccctggtcgttacagag
aagatgcaggtgttcagcaccctcaatggcactgaagggctgcccctgattgcctccaag
tactccatgacagtgatggtctttgtgatgatgctaagtttttactactttgcccgacat
gtggaaaaactggcccggaccctgttcctgtggaagattgaagtccacgaccaaaaagaa
cgtgtgtatgagatgagacgctggaacgaagctctggtcaccaacatgctgcccgagcat
gtggcccgtcatttcttgggctctaagaaacgggatgaggaactgtacagtcagtcatat
gatgaaattggagtcatgtttgcctccctgcccaactttgctgacttctacacagaggag
agtatcaacaatggtggcattgagtgtctccgtttccttaatgagatcatctctgacttt
gactctctcctggacaaccctaaatttcgtatcatcaccaagatcaagaccattggcagt
acctatatggcagcatcaggtgtcaccccagatgtcaacaccaatggctttgccagtggc
aacaaggaggaaaagtcggataaggagcgctggcagcatcttgcagatctggctgacttt
gctttggctatgaaggatactctcactaacatcaataatcagtctttcaataacttcatg
cttcgcataggtatgaacaaaggaggagtcctagctggggtcataggggctcgaaaaccc
cactatgacatttgggggaatactgtcaatgtggccagcaggatggagtcaacaggggtc
atgggcaacatccaggtggtggaggaaacacagaccatcctgaaggaatatggtttccgc
tttgtgagacgaggtcccatcttcgtcaaaggaaagggtgaactgctgaccttcttcctg
aagggacgggataagccagcccccttccctaatggctcatctgtcaccctaccccaccag
gtagtggacaactcctga

DBGET integrated database retrieval system