KEGG   Monodelphis domestica (opossum): 100025603
Entry
100025603         CDS       T01031                                 

Gene name
ATF6B
Definition
(RefSeq) activating transcription factor 6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo04022  cGMP-PKG signaling pathway
mdo04141  Protein processing in endoplasmic reticulum
mdo04151  PI3K-Akt signaling pathway
mdo04211  Longevity regulating pathway
mdo04261  Adrenergic signaling in cardiomyocytes
mdo04668  TNF signaling pathway
mdo04728  Dopaminergic synapse
mdo04911  Insulin secretion
mdo04915  Estrogen signaling pathway
mdo04918  Thyroid hormone synthesis
mdo04925  Aldosterone synthesis and secretion
mdo04926  Relaxin signaling pathway
mdo04927  Cortisol synthesis and secretion
mdo04928  Parathyroid hormone synthesis, secretion and action
mdo04934  Cushing syndrome
mdo04935  Growth hormone synthesis, secretion and action
mdo05020  Prion disease
mdo05030  Cocaine addiction
mdo05031  Amphetamine addiction
mdo05034  Alcoholism
mdo05161  Hepatitis B
mdo05163  Human cytomegalovirus infection
mdo05166  Human T-cell leukemia virus 1 infection
mdo05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100025603 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100025603 (ATF6B)
   04022 cGMP-PKG signaling pathway
    100025603 (ATF6B)
   04151 PI3K-Akt signaling pathway
    100025603 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100025603 (ATF6B)
   04915 Estrogen signaling pathway
    100025603 (ATF6B)
   04926 Relaxin signaling pathway
    100025603 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    100025603 (ATF6B)
   04918 Thyroid hormone synthesis
    100025603 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    100025603 (ATF6B)
   04925 Aldosterone synthesis and secretion
    100025603 (ATF6B)
   04927 Cortisol synthesis and secretion
    100025603 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100025603 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    100025603 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    100025603 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100025603 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    100025603 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    100025603 (ATF6B)
   05031 Amphetamine addiction
    100025603 (ATF6B)
   05034 Alcoholism
    100025603 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100025603 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100025603 (ATF6B)
   05161 Hepatitis B
    100025603 (ATF6B)
   05163 Human cytomegalovirus infection
    100025603 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mdo03000]
    100025603 (ATF6B)
Transcription factors [BR:mdo03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    100025603 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf GIT_CC DUF4407 ZapB YabA
Other DBs
NCBI-GeneID: 100025603
NCBI-ProteinID: XP_001376477
Ensembl: ENSMODG00000014920
UniProt: F7FVR9
LinkDB
Position
2
AA seq 708 aa
MAAELLLLSEIADPARFFADNLLSAEDWDRTLFNCLDEVTEEQAQLFRCLEQDVPFDSGS
LDVGMDITSPEPPWDPLPIFPDLQVKSEPSSPCSSSSLSSESSLLSTEPLSQASVGEEVL
GVKIESPNPPHCLLGNVLKPSFGAVQISVGLTPDEPSDIQTKTEPISPSSPLTSEASLLS
TESPSKPLVEEEVLGVKTESPAPQLCLLGDVLTSSFGSVQINVGPTPDGPSGKAPSHRKP
PLQPKPVMMTNVPLPPRNSPPSTTVLLQPLGQPPPVTSGPSVVLFQGPVQVQPPVGEGPA
PPTPRLERKSIVPAPMPGTPCPPEVDVKLLKRQQRMIKNRESACQSRRKKKEYLQGLEAR
LQVVLADNQQLRRENAALRRRLEGLLAENSELKFGSGNRKVICVMVFLLFIAFNFGPVSI
NESPPAPASPQMSREEPWPQRHLLEFSEQRVASGEDTQGPSLDHKESQPRPPGQPHFKNL
TTFPKGAKELLLRDLDQFFLSSDCRHFNRTESLRLADELSGWVQRHQSGRKRSPQPRKVR
EKQKSHQWKKPPPAWSVPPRPSGPPERDSVSQLQLYHHPRRPQPEFLDAIDRREDTFYVV
SFRRDHLLLPAISHNKTSRPKMSLVMPAMTPNETLSGRGSTGDYEVMMQIECEVMDTRVI
HIKSSTVPPSLRKQTPPPPGNASGNPLPPPAPSSSRQAPHQPFYLGHP
NT seq 2127 nt   +upstreamnt  +downstreamnt
atggcggcggaactgctgctgctcagcgaaatcgccgatccggctcgtttcttcgccgac
aacctgctcagcgctgaggactgggaccgcaccctctttaattgccttgatgaagtgact
gaggagcaagctcagcttttcagatgtctggagcaagatgtcccgtttgatagcggctcc
ctggacgtgggcatggacatcacctcccctgagcccccatgggacccactgcctatcttc
ccagacctacaggtgaagtcagaaccttcttccccttgctcctcctcttctctcagctcc
gagtcatcacttctctccacggagcccctcagccaggcctctgtgggggaagaggtactt
ggtgtgaagatagagtctcctaaccctccacactgcctcttggggaatgttctgaaacct
tcatttggagctgtccagattagtgtgggcctcaccccagatgaaccctcagatatacag
accaagacagaaccaatttcaccttcttcccctcttacctcagaggcctcgttactcagc
acagaatcccctagtaagcctcttgtagaagaggaggtcttaggagtaaagacagaatca
ccagcccctcagctctgccttctaggggatgtcctgacttcctcatttggatcagttcag
attaatgtgggtccaacccctgatggtccatcaggaaaggccccatcccaccggaagcca
cccctacaaccaaagcctgttatgatgacaaatgtcccactgccaccccgaaattcacct
cctagcaccacagtcctgctgcagcccctaggccaacccccaccagtcacatctgggcct
tcagtagtccttttccagggccctgttcaagtacaaccacctgttggggaggggccagct
ccccccaccccccgtttggagaggaagagcattgtcccagctcccatgcctggtactcca
tgccctccagaggtggatgtgaagctgctgaagcgtcagcagcggatgatcaagaaccgt
gagtcagcctgccaatcccggcggaaaaagaaggaatatctgcaagggctggaggcccgg
ctccaagtagtcctcgcagacaaccagcaactccgacgtgagaatgcagctctccgacga
cggctagaggggctgctggctgagaacagtgaactaaagtttgggtctgggaacagaaag
gtcatctgtgtcatggtcttcctcctcttcatcgccttcaattttgggcctgtcagcatc
aatgaatcacctccagctccagcctcacctcagatgagcagggaagagccttggccccag
aggcacctcctggagttctcagaacaaagggtagcttctggggaagacacccaggggcca
tcactggaccataaggaatcacagcccaggccccctggccagccacatttcaagaaccta
acaacctttcccaagggagccaaggagctcttgctaagagacttagaccagttcttccta
tcctctgactgtcgtcacttcaaccggaccgagtctctcaggcttgcagatgagcttagt
ggctgggtccagcgacaccagagtggaagaaagaggagtcctcagccccggaaggtcaga
gaaaaacagaaatctcatcaatggaaaaaaccacctccagcctggtcagtccctcctcgg
ccctctggcccccctgaaagggactctgtgagccaactacagctgtaccaccaccccagg
cgtccacagccagagttcttggatgccattgaccgtcgggaagacacattctacgttgtc
tccttccgaagggatcacctgttgctcccagcaatcagccacaacaagacttctcgccca
aagatgtctttggtgatgccagccatgacccccaatgagaccctttctggtcggggcagc
acaggggactatgaggtgatgatgcagattgaatgtgaggttatggacaccagggtcatc
cacatcaagagctctacggtgcccccctcccttcgaaagcagaccccacctcctcctggc
aatgcttcaggcaaccccttgcctcctccagcacccagctcttctaggcaagctcctcac
cagcccttctacctcggtcacccctaa

DBGET integrated database retrieval system