KEGG   Monodelphis domestica (opossum): 100025797Help
Entry
100025797         CDS       T01031                                 

Gene name
ACE
Definition
(RefSeq) angiotensin I converting enzyme
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo04614  Renin-angiotensin system
mdo04924  Renin secretion
mdo05142  Chagas disease (American trypanosomiasis)
mdo05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    100025797 (ACE)
   04614 Renin-angiotensin system
    100025797 (ACE)
 09160 Human Diseases
  09165 Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    100025797 (ACE)
  09167 Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    100025797 (ACE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mdo01002]
    100025797 (ACE)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mdo04147]
    100025797 (ACE)
   04090 CD Molecules [BR:mdo04090]
    100025797 (ACE)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     100025797 (ACE)
Peptidases [BR:mdo01002]
 Metallo Peptidases
  Family M2
   100025797 (ACE)
Exosome [BR:mdo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100025797 (ACE)
CD molecules [BR:mdo04090]
 Proteins
  100025797 (ACE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 100025797
NCBI-ProteinID: XP_016285047
LinkDB All DBs
Position
2
AA seq 1655 aa AA seqDB search
MFFSARSCPGPLVRQLFLLLLLLICLLLPPAQALSAELMPGNFTADEAGARLFADSYNSS
AEVILYESTVASWTYNVNITQENAQRQSMISQWKRRQSLGTSNDAKKCAHRYFVSFVLQF
QFHKALCAEANYSGPLHYCDIYQSQEAGVKLREVLQAGASRPWQEVLKGLTGSEILDAEP
LLEYFKPLITWLQEQNQINGEVLGWPDFEWRPPVPDGYPEGIDKLADEAEAEKFLEEYVR
LRQVITNAYVETSWAYNTNITDENSKIMLEKNLEVSQHTLQFGTRARQFDTSNFQKSSVK
RLLEKLQDLGRAALSTTDLNEYNNVLLKMESVYSKAKVCQENGSCLPLDPDLTNLMAVSR
DYDNLLWAWKGWRDVTGQAILPSFPEYVDLSNKAAQLNGYADAGASWRSQYETSSLEEQL
EKIYLELQPLYLNLHAYVRRALYRHYGANYINLQGPIPAHLLGNMWAQSWSNIYELVVPF
PSASQVDATPAMKSQNWTAQRMFEEADKFFQSLGLLPLPPEFWDKSMLEKPKDGRDVVCH
ASAWDFYNGKDFRIKQCTVVNMEDLIVIHHEMGHVQYFMQYKDQPLTFREGANPGFHEAI
GDVLALSVSTPKHLHSIGLLDNEGEGYESEINYLMSIALDKIAFLPFGYLIDQWRWRVFD
GSINKKDYNQEWWNLRLKYQGLCPPVPRSQEDFDPGAKFHIPANVPYLRYFVSFVIQFQF
HEALCRAAGHTGPLYKCDIYQSKEAGKLLADAMKLGLSQPWPEAMKLITGQPNMSATAIM
NYFQPLLDWLITKNKEQGETLGWPQYDWTPYSGASSAPNVPNSGKVSFLGMELERGQATA
GQWVLLVLGLVLLVATMGLAYKTCSLKRREEPYFGSEVELRHSCHIVGFWLVGRYTVSQF
VCPLAMDRYWIFSLGSSIFLLCSCGQFLSLLRVGKAETSEEDDHSLPNSPKRTSESEEEA
NTFLKEYEKTALIVWHDYVEAAWNYNTNITLYNRQQMLEKNFLMAQHTLYYGTKALQFNI
TNFTDPLLKRILWKLREMERAILPQDDLMEYNQLLTNMETIYNMGDVCSEEGPCMFLEPD
LLKVMAFSRNYNELLWAWQGWRDTMGQQLRPIYTRFVELSNKAARLNGHTDTGASWRQIY
ESPTLEQDLEQLYQQLEPLYLNLHAYVRRALYNYYGSQYINLKGSIPAHLLGNMWGQSWI
NIIDLVIPFPLSTRINVTMLMKSQHWTPYKMFEEADKFFQSLGLFPVLPEFWAKSMLEKP
GDGRAMSCQASAWDFYDGKDFRIKQCTGVNMEDLISVFHEMGHIQYFMQYKNLPLPLRDG
ANPGFHEAIGDVAALSVSSLKYLHNSDLLINEIEDYESEINFLMSIALKKIAFIPFSYLV
DQFRWRVFDGRITKQFYNKKWWDLRLKYQGLCPPVPRSEEDFDPGSKFHIAGNVPYIRYF
ISFVIQFQFHEALCQAAGHKGPLHTCNIYSSQEAGKLLGDVMKLGFSKPWPEAMKMITGQ
YNMSAKPLMEYFKPLLDWLIAENVRNEEVLGWPEFGCFIYDDAEKKVRILPLSLNSTNTV
AGQWLLLAMCLLLMLLIASLLYEAVAEQYRTSDPDKEGTFPGIPGKIPHAVRSQYLLFIL
SLFLLLSVVLLSVCVFFLNSKKHWNFSSNREQSEK
NT seq 4968 nt NT seq  +upstreamnt  +downstreamnt
atgttcttctcagcccggagctgccctgggccgctcgtgcggcagcttttcctcctgctg
ctgctgctgatctgtcttcttctgccgcctgcccaggccctatccgccgagctgatgccc
gggaattttaccgccgacgaggccggggcgaggcttttcgccgacagctacaactcctca
gcggaggtcatcctgtatgagagcaccgtggccagctggacttacaacgtcaacatcacc
caagagaacgcgcagcggcagtcgatgataagccaatggaagcggaggcagagcttgggt
acttccaatgatgccaagaaatgtgcccacaggtattttgtgagttttgtccttcagttc
caattccacaaagccctgtgtgctgaggcgaactacagtgggcctctacactactgtgac
atctaccaatctcaagaggctggtgtcaaactcagggaggtgttgcaggcaggtgcttct
cggccatggcaggaggtgcttaagggattgacaggctcagagatcctggatgcagaacca
cttcttgaatacttcaagcccctcatcacctggctgcaagaacagaaccagatcaatggc
gaggtcctgggctggcctgattttgagtggcgtccaccagtgccagatggctatccagag
ggcatcgacaagctggctgatgaagcagaggctgagaagttccttgaggagtatgtccgg
ttgaggcaagtcataacgaatgcttacgtagagaccagctgggcttacaacacaaacatc
accgatgaaaatagcaagattatgttggaaaagaacctggaggtgtctcaacacacgcta
caatttggcacccgtgcccgccagtttgataccagcaatttccagaagtcctctgtgaag
cggctcttggaaaagcttcaagatctgggtcgagcagccctctccactacagatttgaat
gagtacaataacgtactgttgaagatggaatcggtatacagtaaagccaaagtgtgccag
gaaaatggttcctgtttacccctggatcctgatttgacaaatttgatggctgtatctcgg
gactatgacaacttgctatgggcttggaaaggttggagggatgtgacaggacaagctatc
cttcccagcttcccagagtatgtggaccttagcaacaaggctgctcagctcaatggctat
gccgatgctggagcctcctggagatctcagtatgaaacatcttccttggaggagcaactg
gagaaaatctatctggaactgcagccactctacctgaacctacatgcctatgtccgtcgt
gcactgtaccgtcattatggagccaactacatcaatcttcaagggcccattcctgctcat
cttttaggcaacatgtgggctcaaagctggtccaacatttatgagttggtggtgcccttc
ccctctgccagccaggtagatgccactccagctatgaaaagccagaactggactgcccag
aggatgtttgaagaggcagacaaattcttccagtccctgggtctgttgcccttaccccct
gagttttgggacaagtcaatgctggagaagccaaaagatgggcgagatgtagtatgtcat
gcttctgcctgggatttctacaatggcaaggacttcaggatcaaacagtgcacagttgta
aacatggaggacctcattgtcatccaccacgagatgggccatgtgcaatatttcatgcag
tacaaagaccaacctctgaccttccgagagggtgctaacccaggttttcatgaggctatt
ggagatgtgctggctctctctgtctctacccccaagcacttacatagtattgggctgctt
gataatgagggagagggctacgagagtgagatcaactacctgatgagtattgcactggac
aagattgccttcctcccttttggttacctcattgaccagtggcgctggcgggtgtttgat
gggagtatcaataagaaagattataaccaggaatggtggaatctcaggctaaagtaccag
ggtctgtgtccaccagtgccaagatcacaagaagattttgacccaggtgccaagttccac
atacctgcaaatgtaccctatctcagatactttgtcagctttgtgattcagttccagttc
cacgaggccctgtgccgagccgctggccacacaggcccactttacaagtgtgacatctat
cagtcaaaggaggcagggaagctcttggcagatgcgatgaagctgggactcagtcaaccc
tggccagaagccatgaagctaattacagggcagcccaacatgtcagctacagctattatg
aactatttccagcccctcctggattggcttatcaccaagaacaaggagcagggagagaca
ctaggctggcctcagtatgactggactccatattctggtgcctccagtgctcccaatgta
ccgaacagtggcaaagtcagcttcttgggaatggagctggagcgtgggcaggctacagca
gggcagtgggtactgcttgtcctgggcctggtgttgcttgtggctacaatgggcttggcc
tataagacatgtagcctcaaacgtagagaggagccttattttggctctgaggtggagctg
agacactcctgtcacattgttgggttctggttggttgggagatacacagtctcccagttt
gtatgtcctttagctatggacagatattggattttttcccttgggtcttccatatttcta
ctttgctcttgtgggcagttcctctcactgctcagagtggggaaagctgagacttcagaa
gaggatgaccatagtctccccaactctcccaaaagaacatcagaaagtgaggaagaggca
aatacattcctgaaagagtatgaaaagacagctctaattgtgtggcatgattatgtggaa
gctgcctggaattacaacaccaacatcactctgtataatcgtcagcaaatgctggaaaag
aacttcctgatggctcagcatacattatattatggcacaaaggctctccaatttaatatc
accaacttcactgacccactactgaagcgcatcctgtggaagctgagggaaatggagagg
gccatccttccccaggatgaccttatggagtacaatcaacttctaacaaatatggagaca
atctacaacatgggtgatgtgtgctcagaagagggaccttgcatgttcctggagcctgac
cttctaaaggtgatggccttctccaggaactataatgaacttctctgggcatggcaaggt
tggagggacactatgggccaacagctgcgccccatctacactcggtttgtggagctcagc
aacaaggctgccaggctcaatggtcacacagatacaggggcctcctggagacagatatat
gagtcacccaccttggaacaagaccttgagcagctctatcagcaactagaaccactctac
ctaaacctgcatgcttatgtgcgccgagctctttacaattactatggatctcaatacatt
aacctaaagggatccattcctgcccacctactggggaatatgtggggtcagtcctggatc
aacataattgacctagtcataccctttcctttatccaccagaataaacgtcaccatgctc
atgaaaagccagcactggacaccctataagatgtttgaggaggctgacaaattcttccag
tctctggggctgttccctgttctccctgaattctgggccaaatcaatgttggagaagcca
ggggatggaagagcaatgtcgtgccaagcttctgcctgggacttctatgatggaaaggac
ttcaggataaagcagtgcactggggtgaatatggaagatctgatatccgtcttccatgag
atgggccatatccaatacttcatgcagtacaagaatctgcccttgccactccgagatggg
gccaacccaggcttccatgaggccataggggatgtggcagccctctctgtctcctccctc
aagtaccttcacaactcagacctgctgatcaatgaaatagaggactatgaaagtgaaatc
aacttcctcatgagtatagcattgaaaaagattgccttcatccccttcagctacctggtg
gaccagtttcgttggagagtctttgatggccgcatcaccaagcaattttacaataagaaa
tggtgggacctaaggttaaaatatcagggattgtgcccaccagtgccaaggtcagaggaa
gactttgacccaggttctaagttccatattgctggcaatgtgccttatatcagatatttt
atcagctttgtgatccagttccaattccatgaggccctgtgccaagccgcaggccacaaa
ggccccctacacacatgtaatatatacagctcccaagaagcaggaaaactcctgggggat
gtcatgaaacttggattcagtaagccatggccagaagcaatgaagatgattactggacaa
tataacatgtcagcaaaacctctcatggagtactttaagcccctgcttgactggctcatt
gcagagaatgttcgtaatgaagaagtcctgggttggcctgaatttggctgcttcatctat
gatgatgcagaaaaaaaagtgagaatcctgcctctgagtttgaactccaccaacacagtt
gctgggcagtggctgctgctggccatgtgcctactactaatgctgctcatagcaagtcta
ctctatgaggctgtagcggagcaatacaggacatctgaccccgataaggaaggcacattt
cctgggatccctgggaaaatcccgcatgctgtcaggagccagtacctgcttttcatcttg
agtctgtttctgctgctctctgtggtgttgctctctgtctgtgtcttcttcctcaactcc
aagaaacactggaatttcagttccaatagggaacaaagtgaaaagtag

DBGET integrated database retrieval system