KEGG   Monodelphis domestica (opossum): 100026169Help
Entry
100026169         CDS       T01031                                 

Gene name
ABAT
Definition
(RefSeq) 4-aminobutyrate aminotransferase
  KO
K13524  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00250  Alanine, aspartate and glutamate metabolism
mdo00280  Valine, leucine and isoleucine degradation
mdo00410  beta-Alanine metabolism
mdo00640  Propanoate metabolism
mdo00650  Butanoate metabolism
mdo01100  Metabolic pathways
mdo04727  GABAergic synapse
Module
mdo_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    100026169 (ABAT)
   00650 Butanoate metabolism
    100026169 (ABAT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100026169 (ABAT)
   00280 Valine, leucine and isoleucine degradation
    100026169 (ABAT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100026169 (ABAT)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    100026169 (ABAT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mdo01007]
    100026169 (ABAT)
Enzymes [BR:mdo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     100026169 (ABAT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     100026169 (ABAT)
Amino acid related enzymes [BR:mdo01007]
 Aminotransferase (transaminase)
  Class III
   100026169 (ABAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Tex_N Lenti_VIF_2
Motif
Other DBs
NCBI-GeneID: 100026169
NCBI-ProteinID: XP_007498735
Ensembl: ENSMODG00000005781
UniProt: F6XY07
LinkDB All DBs
Position
6
AA seq 500 aa AA seqDB search
MASMLLSRQLTCAIQQYCRLFVPGCRSVSQAAAKIDVDFDYDGPLMKTEVPGPRSRELMK
QLNGIQNAESVHFFCNYNESRGNYLVDVDGNRMLDLYSQISSLPIGYSHPALVKLVQQPQ
NVGTFINRPALGVFPPDNFPEKLKESLLSVAPKGLSQIVTMSCGSCSNENAFKTIFMWYR
NKERGHTAATKEELDTCMINQYPGCPDYSILSFMGAFHGRTMGCLATTHSKAIHKLDIPS
FDWPIAPFPRLKYPLEEFVKENQQEEARCLEEVEDLIVKYRKKKKTVAGIVVEPIQSEGG
DNHASDDFFRKLRDIARKHGCAFLVDEVQTGGGCTGKFWAHEHWGLDDPADVMSFSKKMM
TGGYFHKEEFRPNAPYRIFNTWLGDPSKNLLIAEVINVIKREDLLSNVTHAGKALLTGLL
DLQARYPHLISRARGRGTFCSFDAPDETTRNKFILKARNKGVVLGGCGDRSIRFRPTLVF
RDHHAHLFLNIFSDILADFK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcttccatgctgctcagtcgacagctgacctgtgcaatccagcaatattgccggctg
tttgttcctggttgcaggtctgtcagccaagctgcagccaaaattgatgtcgactttgat
tatgatggacctctgatgaagactgaagtccctggacctagatctagagaattaatgaaa
cagttgaatggaattcagaatgcagaatctgttcatttcttttgcaactacaatgagagc
cgaggaaactacctggtggatgtggatggcaaccggatgttagatctttactctcaaatt
tcctcccttcctataggttacagccaccctgctttggtaaagcttgtccagcagccccaa
aatgtgggcacattcatcaacagacctgcccttggagtatttcctccagataattttcct
gaaaagctaaaagagtccttgctttcggtggcaccaaaaggcctctcccagattgtcaca
atgtcctgtggatcctgctctaatgaaaatgccttcaaaactatattcatgtggtacagg
aacaaggagaggggccacactgctgccacaaaggaggagctagatacatgtatgattaac
cagtatccaggttgcccggactacagtatcctctctttcatgggtgcatttcatgggaga
acaatgggttgcctagcgaccactcactccaaagccattcacaagctagacatcccttcc
tttgactggcccattgctccatttccccggctaaagtatcctctggaagagtttgtgaaa
gagaatcaacaagaagaggcccgatgtttggaagaggtagaggacttgattgtgaaatac
aggaaaaagaagaagactgtggcagggattgttgtggagcccatccagtcagagggcggg
gacaaccatgcatcagatgacttctttaggaagctgagagacattgctagaaagcatggc
tgtgcctttctagtggatgaagtacaaactggtgggggatgtactggcaagttctgggcc
catgagcactggggattagatgatccagctgatgtaatgtccttcagcaagaagatgatg
actggaggatattttcacaaggaagagttcaggcccaatgctccttaccggattttcaat
acttggcttggagacccttccaagaatctgctgattgctgaagtcatcaatgtcattaaa
agagaagacctcctcagtaatgttactcatgcaggaaaagcactattgacagggctgctg
gatttacaggccaggtacccacatctcatcagcagagcaagaggtaggggaacattctgc
tcttttgatgctccagatgaaacaacgaggaacaagtttattttaaaagccagaaacaaa
ggtgtagtgctgggaggctgcggtgataggtccatccgtttccgtccaacattggtcttc
agggatcaccatgcacaccttttcctcaacatttttagtgacatcttagcagacttcaag
taa

DBGET integrated database retrieval system