KEGG   Monodelphis domestica (opossum): 100027215Help
Entry
100027215         CDS       T01031                                 

Gene name
INSR
Definition
(RefSeq) insulin receptor
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo04010  MAPK signaling pathway
mdo04014  Ras signaling pathway
mdo04015  Rap1 signaling pathway
mdo04022  cGMP-PKG signaling pathway
mdo04066  HIF-1 signaling pathway
mdo04068  FoxO signaling pathway
mdo04072  Phospholipase D signaling pathway
mdo04150  mTOR signaling pathway
mdo04151  PI3K-Akt signaling pathway
mdo04152  AMPK signaling pathway
mdo04211  Longevity regulating pathway
mdo04213  Longevity regulating pathway - multiple species
mdo04520  Adherens junction
mdo04910  Insulin signaling pathway
mdo04913  Ovarian steroidogenesis
mdo04923  Regulation of lipolysis in adipocytes
mdo04930  Type II diabetes mellitus
mdo04931  Insulin resistance
mdo04932  Non-alcoholic fatty liver disease (NAFLD)
mdo04960  Aldosterone-regulated sodium reabsorption
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100027215 (INSR)
   04015 Rap1 signaling pathway
    100027215 (INSR)
   04010 MAPK signaling pathway
    100027215 (INSR)
   04066 HIF-1 signaling pathway
    100027215 (INSR)
   04068 FoxO signaling pathway
    100027215 (INSR)
   04072 Phospholipase D signaling pathway
    100027215 (INSR)
   04022 cGMP-PKG signaling pathway
    100027215 (INSR)
   04151 PI3K-Akt signaling pathway
    100027215 (INSR)
   04152 AMPK signaling pathway
    100027215 (INSR)
   04150 mTOR signaling pathway
    100027215 (INSR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100027215 (INSR)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100027215 (INSR)
   04923 Regulation of lipolysis in adipocytes
    100027215 (INSR)
   04913 Ovarian steroidogenesis
    100027215 (INSR)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100027215 (INSR)
  09149 Aging
   04211 Longevity regulating pathway
    100027215 (INSR)
   04213 Longevity regulating pathway - multiple species
    100027215 (INSR)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100027215 (INSR)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100027215 (INSR)
   04931 Insulin resistance
    100027215 (INSR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mdo01001]
    100027215 (INSR)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mdo04090]
    100027215 (INSR)
Enzymes [BR:mdo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100027215 (INSR)
Protein kinases [BR:mdo01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   100027215 (INSR)
CD molecules [BR:mdo04090]
 Proteins
  100027215 (INSR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain Pkinase Furin-like Insulin_TMD fn3 Kinase-like B2
Motif
Other DBs
NCBI-GeneID: 100027215
NCBI-ProteinID: XP_001377572
Ensembl: ENSMODG00000015101
UniProt: F7F370
LinkDB All DBs
Position
3
AA seq 1378 aa AA seqDB search
MGAARPLTVGLPPLLLLLLLLLSSSCSLSSGEVCPSMDIRNNLTQLNMLERCSVIEGSLQ
ILLMFKTKPEDFRDLSFPRLTMITEYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYALV
IFEMVHLKEIGLYNLMNITRGAVRIEKNNELCYLSTIDWSQILDSVEDNYIVDNKDGKEE
CGDVCPGAVKGVNSCKSTVINGQFIERCWTHSHCQKVCPPSCKWQGCTASGQCCHSECLG
NCIEPNNPEKCVACRNFYLDGKCVETCPPNYYHFQDWRCVNFSVCQELHNKCKNSRQSSC
SQYVIHNNKCIPECPSGYTMNSTNLHCSPCSGPCPKVCDIVADQTIDSVHAAQALRGCTV
INGSLIINIRGGNNIAAELEANLGLIEEITGYLKIRRSYALVSLSFFRKLHLIRGETLEI
GNYSFYALDNQNLRQLWDWSKHNLTITKGKLFFHYNPKLCLSEIHKMEEVSGTKGRQERN
DIALKTNGDQASCENELLRFSSIRTTHDKILLRWEPYWPPDFRDLLGFMLFYKEAPYQNV
TEFDGQDACGSNSWTVIDVEPPVRSNDPKTQNQHPGWLMRNLKPWTQYAIFVKTLVTFSD
ERRTYGAKSEIIYVQTNATVPSVPLDPISVSNSSSQIILKWKPPSEPNGNITHYLVYWEK
QAEDVELYELDYCLKGLKLPSRTWSPPFESEDSQKHNQSNHEDPNGECCSCPKTDSQILK
ELEESSFRKTFENYLHNEVFIPRKASSGIGADDSRPSRRRRDLRFRVANVTVVTPTGSSF
FNASSTTAPASTEEPKPFEKVKSKESLVISGLQHFTGYRIELQACNHDEQESRCGLAAYV
SARTMPEAKADDIVGAVTHEVLEHNIVHLRWQEPKHPNGLIILYEVNYWRVGDTEELHLC
VSRKHYANEQGCRLRGLQPGNYTVRIRATSLAGNGSWTEHTYFYVADYLDVPSNIAKIII
GPVIIAIFLVSMVGAIYVFVKKRQTEGPTGPLFASSNPEYLSASDVYVPDEWEVAREKIS
LLRELGQGSFGMVYEGNAKDIVKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFSCH
HVVRLLGVVSKGQPTLVVMELMVHGDLKSYLRSLRPEAENNPGRPPPTLREIIQMAVEIA
DGMAYLNAKKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMA
PESLKDGVFTTYSDVWSFGVVLWEISSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPER
VNSLMQMCWQYNPKMRPTFIEIIEMLKDDLHPSFREVSFFYSEENKPPESEEFEMDFENM
ESIPLDPSSYSQRDEVLGRDNGPSLGLKGNYEERIPYTHMNGGKKNGRILSLPRSNPS
NT seq 4137 nt NT seq  +upstreamnt  +downstreamnt
atgggggccgcacggccgctgacggtcgggctgcccccgctcctgctgctgttgctgctg
ctgctgagctcttcgtgtagcttgagctccggagaagtgtgcccaagtatggacatccgg
aataacctcacccagctgaacatgctggagcgctgctctgtcattgagggcagtttacag
atcttgctgatgtttaaaacaaagcctgaagattttcgggacctcagtttccccagactt
actatgatcacagagtacttgctgctcttccgagtgtatgggcttgagagcctcaaggac
cttttccccaatttgacggtcattcgtgggtcccgcctctttttcaattatgccctggtc
atcttcgagatggtccacctcaaggagattggcctctataacctgatgaacatcacccgt
ggggctgtacgcatcgagaagaataacgagctgtgctacttgtcaaccattgactggtct
cagatcttagactcagtggaggacaattatattgtggataacaaagatggcaaagaagaa
tgtggggacgtctgccctggggcagtgaagggagtcaacagctgcaagtccactgtgatc
aatggccagtttattgaacggtgctggacccacagccattgccaaaaagtatgtccgcct
tcgtgtaagtggcagggctgtacggcgagtggtcagtgttgccacagcgaatgtctgggg
aattgcattgagcccaacaaccctgagaaatgtgttgcctgccgaaatttctatctggat
ggcaagtgtgtggaaacgtgccccccaaactattaccacttccaggactggagatgtgtg
aatttcagtgtctgccaggagctgcacaacaaatgtaaaaactcccgacagtcctcctgc
tcccagtatgtcatccacaacaacaagtgtatccccgagtgtccctctggctataccatg
aactccaccaacctgcattgttctccgtgctccggtccctgtccgaaagtttgcgacatt
gtggctgaccagaccatcgactctgtgcatgctgcccaggcacttcgagggtgcaccgtc
atcaatgggagcctaatcataaacatccgtggtggcaataacatagcagcagaactagaa
gctaatcttggtttaattgaggagatcacggggtaccttaagattcgtcgttcctatgcc
ttagtgtccctctccttcttccggaagctgcacctcattcgaggagagaccctggaaatt
gggaactactccttctatgctctggacaatcagaacctgaggcagctgtgggactggagc
aaacacaaccttaccatcaccaaggggaagctcttcttccactataaccccaaactctgc
ctgtctgaaatccacaaaatggaagaagtttctggcacaaagggccggcaagagaggaat
gatattgcattgaagaccaatggcgaccaagcttcttgtgaaaatgagctgctcaggttt
tcttccattagaaccactcacgacaagatcttactgaggtgggagccttactggcctcct
gatttccgagacctcttgggattcatgttgttctacaaagaagcaccttaccagaatgtg
actgagtttgatggccaagatgcttgtgggtcaaatagctggacagtgattgatgtcgaa
cccccagtgagatcaaatgatcccaaaactcagaatcaacacccagggtggttgatgaga
aacctgaagccatggacccagtatgccatctttgtgaaaaccctagtcactttctctgat
gaacggagaacctatggtgccaagagtgagatcatttatgtccagaccaatgccactgtt
ccttcagtcccattagacccaatatccgtttccaattcttcatcccagatcattttaaag
tggaaaccaccctctgagccaaatggtaatattacgcactacttggtgtattgggagaag
caagcagaagatgtcgagctctatgaacttgattattgccttaaggggttaaagttgcca
tcgaggacctggtcccctccctttgagtctgaagattctcagaaacacaaccagagcaac
cacgaggatcctaatggtgaatgttgctcttgcccaaagacagactctcagatcttgaag
gagctggaagaatcttcctttaggaagacgtttgaaaattacctccacaacgaggttttc
atccccagaaaagcatcctcagggattggcgctgacgactctaggccgtcgaggaggcgg
agggatctccggtttcgtgtggcaaacgtgactgtggtgacacccacggggtcctcgttc
ttcaatgcctcttccacgactgctccggccagcacggaggagccgaagcccttcgagaag
gtgaagtctaaggagtccctggtcatctctggcctacagcacttcactggctacaggatc
gagctccaggcatgcaaccatgatgagcaggagtccaggtgtggccttgccgcttatgtc
agcgcaagaaccatgcctgaagccaaggcagatgatattgttggtgcagtgacgcatgag
gtacttgagcataacattgtacatttgcgatggcaggagcccaagcatcccaatggcctt
attattttgtatgaagtcaattactggcgagttggagacacagaggaactgcatctctgt
gtttcccgcaaacattatgccaacgaacagggctgcagactccgaggtctacagccaggc
aactacaccgttcgtatccgagctacctctttggcaggaaatggttcatggactgagcac
acctatttctacgtggccgattatttagacgtcccatcaaatattgcaaaaattatcatt
ggtccagtcatcatcgccattttcttggtcagcatggttggagctatttatgtctttgtg
aagaagaggcaaacggaaggaccgacgggccccctgtttgcttcttccaatccagaatac
ctcagtgccagtgatgtttatgtaccagacgagtgggaagtagctcgagagaaaatcagc
ctcctccgtgaacttggccaaggctcttttggcatggtctatgagggcaacgccaaggac
atcgtcaagggggaggctgagacccgtgtggccgtgaagacggtgaatgagtctgccagc
ctccgggagcgtattgaattcttgaatgaggcttctgtcatgaagggcttcagctgccat
catgtggtccgcctcctgggagtggtctccaaagggcagcccaccttggtggtcatggaa
ctgatggtgcatggggacctgaagagttatctccgttccctgcggccagaggcagagaac
aaccctggtcgccctcctcccaccctccgggagatcatacagatggctgtggagattgca
gatggcatggcctacttgaatgccaagaaatttgttcacagagaccttgctgcccggaat
tgtatggttgctgaagactttactgtaaagataggagactttgggatgaccagagacatc
tatgagacagattattatcgcaaagggggcaagggtttgctgccagtgaggtggatggct
ccagaatctttaaaggatggggtctttactacctattcagatgtgtggtcctttggcgta
gtcctatgggagatcagcagcctggctgagcagccttaccaaggcctgtccaatgagcag
gtcctgaaatttgtgatggatggagggtacctggaccaacctgataactgtccagagaga
gtgaacagcctaatgcaaatgtgctggcagtataaccccaagatgcgccctaccttcatt
gagatcatcgagatgctgaaagacgacctccaccccagcttccgggaggtctcctttttt
tacagtgaagaaaacaagcctcctgagagcgaggagtttgagatggacttcgaaaacatg
gaaagcatccccctggacccttcttcttactcccagagagacgaggtcctggggagggac
aatgggccatctctgggccttaagggaaactatgaggaacggataccttatacccacatg
aatgggggcaagaagaatggacgtatcctctctttgccaaggtcgaacccttcctaa

DBGET integrated database retrieval system