KEGG   Monodelphis domestica (opossum): 100028710Help
Entry
100028710         CDS       T01031                                 

Gene name
SETDB2
Definition
(RefSeq) SET domain bifurcated 2
  KO
K18494  histone-lysine N-methyltransferase SETDB2 [EC:2.1.1.43]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100028710 (SETDB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mdo03036]
    100028710 (SETDB2)
Enzymes [BR:mdo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100028710 (SETDB2)
Chromosome and associated proteins [BR:mdo03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100028710 (SETDB2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100028710 (SETDB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET zf-HC5HC2H Pre-SET MBD zf-HC5HC2H_2
Motif
Other DBs
NCBI-GeneID: 100028710
NCBI-ProteinID: XP_016288713
LinkDB All DBs
Position
4
AA seq 1018 aa AA seqDB search
MAHKLVCILTHCHSLQPSISFSLSCDAKAFWRELEEDGKLDLIFEHVQNVLLSLKQKIKD
GSATNQEYIQAMTLVNEAVTSNTLLLIKDDDITDRDSEQESKSSILPPTSQEDSNSEDSL
ILTVEDIAVLTLENEVSNYEEKILALSLPYQSHDCCDTCLPKIPLTSKVENPLMIPILCR
FQRRHAKTNSNYATFHVNYKTPCGRSLRNFKEVHRYLLETESSFLFLHNFSFNTYVQLNR
NTPKKEVFVSDSDISHGTESVPITFCNEIDNRRLPHFKYRRRTWPRAYYLNNFSGMFSNS
CDCSKGCMDITKCACLQLTAKGYDESSAYDQNVKPTHGYSYKRLQQPVPNGIFECSLLCK
CDPRTCQNRVVQQGLQVRLQVFKTEKKGWGVRCIDDIDKGTFVCTYSGRLLSRVGLEEIG
SVDGKEEEEEEDAATNDNGPPALSKKRRTEAAYSDPEIEFVQVEVGAIPGDSETQEYLIQ
LSSDANPSIQGEKYEYDLRTENQPATRRPKTKTALLQNYRKKRGIVTLESGISSDEEDEV
QSPEVQTTPNIREEKMESSCSGENSKEKLLTTSTGLDNHHCKAERLVENIGDPLASMFDM
SGIKECKDRDQVSHEERTRERQNQEIFCDEESLSEVQIGVSESIKKFCEDGIYLLDATKE
GNVGRFLNHSCNPNLFVQNVFVETHDRNFPWVAFFTKRHVKAGTELTWDYGYEAGSIPEK
EIPCQCGFHTCRKRITPGRGAGHLPFSRMSSPTPTELSLEEPGLALSIMATDEALRDPAG
IFQERMVKITCDLCPQDDERGILYVSQDLECVAHQNCLLYSSGLVESEGNHPCLNEEDRN
FDVKLVNEEISRGKRLKCSFCLRKGATVGCDIKKCPKNYHFFCARQDHAILKADDSIGIY
RVFCQKHATGSSNLDLLKKMKKAGLIENLFEALLEDLDGIHSKINDTTTSEKELQEIATS
LFDCAIFKKTLKKLSTETVIKKLQREQVQLQRKIEVLQGIRERMPLPQEDSIKHSAGP
NT seq 3057 nt NT seq  +upstreamnt  +downstreamnt
atggcccataaactagtatgtattctaacccattgtcattctttgcagccatccatctct
tttagtttgtcatgtgatgcaaaagctttttggagggaactggaagaggatggaaaattg
gacttgatatttgaacatgtacagaatgtactgttgtcattgaaacaaaagatcaaagat
gggtcagccacaaatcaagagtacatccaagccatgaccctggtgaatgaagcagttaca
agtaacactttactcttgataaaagatgatgatataactgacagggacagtgaacaagaa
agcaaatcaagtattttacctccaacatcacaggaagactccaattcagaagactcattg
attttaaccgtggaggacatagcagttctaactttggaaaatgaagtttcaaattatgaa
gagaaaatactagctttgagtctgccctatcagagtcatgactgctgtgatacatgtctg
ccgaaaatacctctcacctccaaagtagaaaacccactcatgatccccatcttatgtcgt
ttccaaaggcgacatgcaaagacaaattctaattatgccacattccatgtgaattataaa
accccttgtggaaggagtttgagaaactttaaggaagttcaccgttacctgcttgagaca
gaaagtagctttttatttttgcataatttttctttcaatacctatgtgcagttgaatagg
aatacaccgaagaaagaagtctttgtttctgactctgatatcagccatggaactgaatct
gtgcctattaccttctgtaatgaaattgacaacaggaggctgccacacttcaagtaccgg
aggcggacgtggccacgtgcctactacctcaacaatttctctggcatgtttagtaattca
tgtgactgctcaaaaggatgcatggatataacaaaatgtgcatgcctccagctgacagca
aagggctatgatgagagttctgcatatgatcagaatgttaaacccactcatggctatagc
tataaaagactgcagcagccagtacccaacggaatttttgaatgcagcctcttatgcaaa
tgtgatccaagaacatgtcagaatagagttgtccagcagggtctccaagtgcgccttcag
gtgttcaaaactgagaagaagggatggggagtccgctgcatagatgacattgacaaaggg
acatttgtttgcacttactcagggagattactaagcagagttggcctagaagaaattggc
tctgttgatggaaaagaggaagaggaggaggaggatgctgctaccaatgacaatgggccc
ccagcactttcaaagaagaggagaacagaagctgcttattctgatcctgaaattgagttt
gtccaggttgaagtgggagcgattcctggagactcggagactcaggagtacctgattcag
ctcagcagtgatgcaaatccatctattcagggtgagaagtatgaatatgatctaagaact
gaaaaccaaccagccactagaagacctaaaactaaaacagcccttcttcaaaattatcgg
aaaaaaaggggaattgttaccctggagtctggtataagctcagacgaggaggatgaagtt
caatcacctgaagtccaaacaactcccaatatcagggaagagaaaatggagtctagctgc
tctggtgaaaattccaaagaaaagctgttgaccacatctaccgggctggataaccatcat
tgtaaagcagaaaggctagtagagaacataggtgatccactggcctcaatgtttgatatg
agtggaataaaagaatgtaaggatcgggaccaagtctcccacgaggaaagaacacgggaa
aggcaaaatcaagaaatcttttgtgatgaagagtcactatctgaagtacaaataggtgtt
tcagaatctataaagaagttttgtgaagatggcatttacttattggatgctactaaagaa
ggaaatgtgggtcgcttcctgaatcatagttgtaacccaaatctcttcgtacagaatgtt
tttgtggagactcatgacagaaactttccatgggtggcattcttcacaaaaaggcatgtg
aaggcaggaacggaactcacgtgggattatggttatgaagctgggagtatacctgagaaa
gagattccttgtcaatgtggctttcacacttgtagaaaaagaataactccgggacgcgga
gccgggcacctccccttctcccgcatgtcttccccaaccccaactgagctctccctggag
gagccaggtctggccctgtcaatcatggcgacggacgaggccctaagagaccccgcaggg
atcttccaggaaaggatggtaaaaataacttgtgatctctgtccacaagatgatgaacgt
ggcatactgtacgtctcacaggatcttgaatgtgtagcacatcaaaattgtttgttatat
tcttctggacttgtagaatctgaggggaatcatccttgtttaaatgaggaagacagaaat
tttgatgtgaagctagtaaatgaggaaatcagtcgaggaaagagactgaaatgttcattt
tgccttcggaaaggagctactgtgggatgtgacattaaaaaatgtcccaagaattaccat
ttcttttgtgccagacaggaccacgccatactgaaagctgatgactctattggaatttac
agagtgttctgccaaaaacatgctactggatcaagtaaccttgatttgctgaagaagatg
aaaaaagctggacttattgaaaatctatttgaagcacttttagaagatcttgatgggatt
cattccaagattaatgacaccaccacttccgaaaaagaattacaagaaattgcaacctca
ctctttgactgtgccatatttaaaaaaacactcaagaaattgtctacagagactgtgata
aagaaacttcagagggaacaggtacagttacagaggaagatagaagtgctccaaggcatc
agagaacgcatgcctcttcctcaggaagatagcatcaaacattcagctggcccttga

DBGET integrated database retrieval system