KEGG   Monodelphis domestica (opossum): 100028995Help
Entry
100028995         CDS       T01031                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00052  Galactose metabolism
mdo00500  Starch and sucrose metabolism
mdo01100  Metabolic pathways
mdo04142  Lysosome
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100028995
   00500 Starch and sucrose metabolism
    100028995
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    100028995
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mdo04147]
    100028995
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100028995
Exosome [BR:mdo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100028995
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil DUF5110
Motif
Other DBs
NCBI-GeneID: 100028995
NCBI-ProteinID: XP_001378877
Ensembl: ENSMODG00000009003
LinkDB All DBs
Position
6
AA seq 927 aa AA seqDB search
MKSYRKLPTRLTHTPGPYGEEEEEEEDEGNEPALEAARKTPSLGKRWLGAAVIVGAVVLV
GTFWVIRAQSPPSGPPEKCDVPEAQRFDCYPERDTVVTPELCGARGCCFLQSSQGGPPWC
FYPPDFPSYALTTLNRTDLGFLGVLTRTTKAHYPKDVLELQLQVDLETDFRLHIKLTDPN
NPRYEVPLEVPNATKKAQNPLYSLDFSRDPFGILVKRRGSGVVLLNTTVAPLIFADQFLQ
ISTLLPSEFLYGLGEHRRGFLHHLDWTTLSFWARDVPPTESYNLYGAHPFYLSLEEAGSA
HGVFLLNSNAMEVVLQPAPALTWRTVGGILDFYVFLGPDPSSVVQQYQQVIGFPSMPPFW
GLGFHLCRWGYGSSNETWQTVKNMRNYLIPQDAQWNDIDYMEGSRDFTVDPEHFSTLPQL
VMDLHKHGQYYVLILDPAISSSQTPGSYAPYDEGLRKGIFINNTHGQPLIGEVWPGLTAF
PDFSNLETHQWWLENLNAFHARIPFDGLWIDMNEPSNFKDGSVDGCTSGELDNPPYKPAV
LGGTLFAKTICTSAKQSLSSHYNLHNLYGLMEAKASASALIAIRGKRPFVISRSTFPSQG
RYSGHWLGDNRSEWKDMYWSIPGLLNFNLFGIPLVGADICGFSGSTTEELCTRWMQLGAF
YPFARNHNTKGEKAQDPVAFSPMARTAMKEALMTRYALLPYLYTLFHHAHHWGDTVARPL
FFEFPQDTNTYALDRQFLWGRNLLVTPVLESGVDSVTGYFPRGLWYDYYTGSSLQSQGER
VKLAAPLDHINVHIREGAVIPTQKPDITSWMSSGNPLLLVVALSQEGMAWGDLFWDDGES
LNTFERGNYSYVVFNVSQNIFTSTVLHSNVEVIYITVDGLTVYGIQKQPQVVTVNGQEIP
FSYLENQVLSMSGLNLNLNRSFSIKWI
NT seq 2784 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcataccgcaagctgcccacccgcctgactcacacccctgggccttatggggag
gaggaggaagaagaggaagatgagggaaacgaaccagccctggaggctgcccggaagacc
ccgtctctggggaagcggtggctgggggccgccgtgatagtgggggccgttgtgttagtg
gggaccttctgggtcatccgggcccagagtcctccatcggggcctccggagaaatgtgat
gtccctgaggcccagagatttgactgctacccggagcgagacacggtggtgaccccggag
ctctgtggggcgagaggctgctgtttcctgcagagcagccagggagggccaccctggtgc
ttctacccccctgattttcccagctatgccttgacgactctgaaccgtacagacctgggc
ttcctgggggtgctgaccaggaccacaaaggcccactaccccaaggatgtgctggagctg
cagttgcaggtggatctggagacagacttccggctgcacatcaagctcaccgaccccaac
aaccccagatacgaggtacctctggaagttccaaacgccacgaaaaaagcccagaatccc
ctctacagccttgatttctccagggatccctttgggattttggtgaaacgtcgggggtca
ggagttgtactgttgaacacaactgtggccccattaatctttgctgaccagttcctccaa
atatctacccttctcccatctgagttcctctatggcctgggggagcaccgccggggcttt
cttcaccacctcgactggaccaccttgagtttttgggcccgggatgtcccacctacggag
tcatacaatctttatggggcgcaccccttctacctgagtttggaggaggcgggatctgct
catggtgtcttcctgctgaatagcaatgccatggaggtggttttacagcctgctccagcc
ctgacctggaggactgtgggggggattctggacttttacgtctttttggggccggatcca
agctctgtggtccagcaataccaacaggtcataggcttcccgagcatgccgcctttctgg
ggccttggcttccatctctgtcgctggggttatggtagcagtaacgagacgtggcagacg
gtgaagaacatgaggaactatctcatcccacaggatgctcagtggaatgacattgactac
atggaaggatctcgggatttcacagttgatccagagcatttcagcacactcccacagcta
gtgatggaccttcacaagcatgggcaatattatgtcctaattctggaccctgccatcagc
agcagtcagactcctggctcttatgcaccttatgatgaaggtttaagaaaggggatcttc
attaacaacacccatggacagccattgattggagaggtatggccaggcctcactgcattc
cctgacttctcaaacttggagactcatcagtggtggctagagaacctgaatgcattccat
gcaagaattccctttgatggactgtggattgacatgaatgaaccgtctaacttcaaggat
ggttcagtggatggctgtacctctggagagctggataatccaccttacaaacctgcggtg
ctgggaggaaccttatttgccaagacaatctgcacctctgcaaagcaaagcctctcctcc
cactataaccttcataacctgtatgggctgatggaggccaaagcctctgccagtgccctg
attgcaatccgtgggaagcgcccatttgtcatttcccgatccacttttcctagtcagggc
cgctactccgggcactggctgggggacaacaggagtgagtggaaggacatgtactggtca
atcccaggcctactaaatttcaatctttttgggattcccttggttggagctgatatctgt
gggttttcaggatctacaaccgaggaactatgtactagatggatgcagcttggagccttt
tatccttttgctcgaaaccacaataccaaaggcgagaaggcccaggatccagtcgcattc
agccccatggctcgaacagcaatgaaggaagccctgatgacccgatatgccctgctgccc
tacctctataccctctttcaccatgcccaccactggggtgacactgtggccaggcccctc
ttctttgaatttccacaagataccaatacctatgccctggatcggcagttcttatgggga
cgaaatctcttggtgacccctgtgctggaatcaggtgtagattctgtaactggctacttc
cccagggggctgtggtatgactattatacgggctcatctctgcaaagccaaggagaaaga
gtgaagttggcagctcctcttgaccatataaatgtacacatccgtgaaggtgctgttatc
cccacccagaaaccggatatcaccagctggatgagcagtgggaaccccttgcttctggtg
gttgccttgtcccaggagggcatggcctggggggaccttttctgggatgatggagagagc
ctgaacacctttgagagaggcaactattcctatgtggtgtttaatgtctcacagaatatt
ttcacatccacggtccttcacagcaacgtagaagtcatttacatcactgtggatgggctg
acagtctatggaatacagaaacagcctcaagtggtcactgtcaatggccaagaaattccc
ttctcctacctggagaatcaggttctcagcatgagtggccttaatttgaacctcaatcgg
tccttctccatcaaatggatttga

DBGET integrated database retrieval system