KEGG   Monodelphis domestica (opossum): 100029103
Entry
100029103         CDS       T01031                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin dependent kinase inhibitor 1A
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo01522  Endocrine resistance
mdo01524  Platinum drug resistance
mdo04012  ErbB signaling pathway
mdo04066  HIF-1 signaling pathway
mdo04068  FoxO signaling pathway
mdo04110  Cell cycle
mdo04115  p53 signaling pathway
mdo04151  PI3K-Akt signaling pathway
mdo04218  Cellular senescence
mdo04630  JAK-STAT signaling pathway
mdo04921  Oxytocin signaling pathway
mdo04928  Parathyroid hormone synthesis, secretion and action
mdo04934  Cushing syndrome
mdo05160  Hepatitis C
mdo05161  Hepatitis B
mdo05163  Human cytomegalovirus infection
mdo05165  Human papillomavirus infection
mdo05166  Human T-cell leukemia virus 1 infection
mdo05167  Kaposi sarcoma-associated herpesvirus infection
mdo05169  Epstein-Barr virus infection
mdo05200  Pathways in cancer
mdo05202  Transcriptional misregulation in cancer
mdo05203  Viral carcinogenesis
mdo05205  Proteoglycans in cancer
mdo05206  MicroRNAs in cancer
mdo05210  Colorectal cancer
mdo05211  Renal cell carcinoma
mdo05212  Pancreatic cancer
mdo05213  Endometrial cancer
mdo05214  Glioma
mdo05215  Prostate cancer
mdo05216  Thyroid cancer
mdo05217  Basal cell carcinoma
mdo05218  Melanoma
mdo05219  Bladder cancer
mdo05220  Chronic myeloid leukemia
mdo05222  Small cell lung cancer
mdo05223  Non-small cell lung cancer
mdo05224  Breast cancer
mdo05225  Hepatocellular carcinoma
mdo05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100029103 (CDKN1A)
   04630 JAK-STAT signaling pathway
    100029103 (CDKN1A)
   04066 HIF-1 signaling pathway
    100029103 (CDKN1A)
   04068 FoxO signaling pathway
    100029103 (CDKN1A)
   04151 PI3K-Akt signaling pathway
    100029103 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100029103 (CDKN1A)
   04115 p53 signaling pathway
    100029103 (CDKN1A)
   04218 Cellular senescence
    100029103 (CDKN1A)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100029103 (CDKN1A)
   04928 Parathyroid hormone synthesis, secretion and action
    100029103 (CDKN1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100029103 (CDKN1A)
   05202 Transcriptional misregulation in cancer
    100029103 (CDKN1A)
   05206 MicroRNAs in cancer
    100029103 (CDKN1A)
   05205 Proteoglycans in cancer
    100029103 (CDKN1A)
   05203 Viral carcinogenesis
    100029103 (CDKN1A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100029103 (CDKN1A)
   05212 Pancreatic cancer
    100029103 (CDKN1A)
   05225 Hepatocellular carcinoma
    100029103 (CDKN1A)
   05226 Gastric cancer
    100029103 (CDKN1A)
   05214 Glioma
    100029103 (CDKN1A)
   05216 Thyroid cancer
    100029103 (CDKN1A)
   05220 Chronic myeloid leukemia
    100029103 (CDKN1A)
   05217 Basal cell carcinoma
    100029103 (CDKN1A)
   05218 Melanoma
    100029103 (CDKN1A)
   05211 Renal cell carcinoma
    100029103 (CDKN1A)
   05219 Bladder cancer
    100029103 (CDKN1A)
   05215 Prostate cancer
    100029103 (CDKN1A)
   05213 Endometrial cancer
    100029103 (CDKN1A)
   05224 Breast cancer
    100029103 (CDKN1A)
   05222 Small cell lung cancer
    100029103 (CDKN1A)
   05223 Non-small cell lung cancer
    100029103 (CDKN1A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100029103 (CDKN1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100029103 (CDKN1A)
   05161 Hepatitis B
    100029103 (CDKN1A)
   05160 Hepatitis C
    100029103 (CDKN1A)
   05163 Human cytomegalovirus infection
    100029103 (CDKN1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100029103 (CDKN1A)
   05169 Epstein-Barr virus infection
    100029103 (CDKN1A)
   05165 Human papillomavirus infection
    100029103 (CDKN1A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100029103 (CDKN1A)
   01522 Endocrine resistance
    100029103 (CDKN1A)
SSDB
Motif
Pfam: CDI Arm_vescicular
Other DBs
NCBI-GeneID: 100029103
NCBI-ProteinID: XP_001378950
Ensembl: ENSMODG00000013527
UniProt: F7D6Q4
LinkDB
Position
2
AA seq 164 aa
MSESPSRTRQIPCSGKLCRNLFGPVDHEQLKQDCQDLMQSCTQEAQRRWNFDFITETPLE
GDFAWERVRGLDLPSIYRPSGPWGREDLGGKRPKPRPSSPALLQMSAQGDHVDLSLSCTV
VPLTPEREEGSRAVTSQPARKHKQTSMTDFYHSKRRLIFYKRKP
NT seq 495 nt   +upstreamnt  +downstreamnt
atgtccgagtcaccgagcagaacccgtcagatcccctgcagtgggaagctttgccggaac
ctctttgggcccgtggaccatgagcagctgaagcaggattgccaagacttgatgcagagt
tgtacccaggaggcccagcgacgatggaactttgacttcatcaccgagacccccctggaa
ggcgactttgcctgggagagggtccgaggcctggatctgccctctatctaccgcccgtca
gggccgtggggcagggaggacctgggggggaagaggccaaagccccggcccagctcccca
gccctgctacagatgtccgcccagggagaccacgtggacctgtccctctcctgcaccgta
gtaccactgaccccagagcgggaggaagggtccagggctgtgacctcccaaccagcccga
aaacacaagcagaccagcatgacggatttctaccattcaaagcgaaggctcatcttctac
aagaggaagccctga

DBGET integrated database retrieval system