KEGG   Monodelphis domestica (opossum): 100030053
Entry
100030053         CDS       T01031                                 

Gene name
RELA
Definition
(RefSeq) RELA proto-oncogene, NF-kB subunit
  KO
K04735  transcription factor p65
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo01523  Antifolate resistance
mdo04010  MAPK signaling pathway
mdo04014  Ras signaling pathway
mdo04024  cAMP signaling pathway
mdo04062  Chemokine signaling pathway
mdo04064  NF-kappa B signaling pathway
mdo04066  HIF-1 signaling pathway
mdo04071  Sphingolipid signaling pathway
mdo04137  Mitophagy - animal
mdo04151  PI3K-Akt signaling pathway
mdo04210  Apoptosis
mdo04211  Longevity regulating pathway
mdo04218  Cellular senescence
mdo04380  Osteoclast differentiation
mdo04620  Toll-like receptor signaling pathway
mdo04621  NOD-like receptor signaling pathway
mdo04622  RIG-I-like receptor signaling pathway
mdo04623  Cytosolic DNA-sensing pathway
mdo04625  C-type lectin receptor signaling pathway
mdo04657  IL-17 signaling pathway
mdo04658  Th1 and Th2 cell differentiation
mdo04659  Th17 cell differentiation
mdo04660  T cell receptor signaling pathway
mdo04662  B cell receptor signaling pathway
mdo04668  TNF signaling pathway
mdo04722  Neurotrophin signaling pathway
mdo04917  Prolactin signaling pathway
mdo04920  Adipocytokine signaling pathway
mdo04926  Relaxin signaling pathway
mdo04931  Insulin resistance
mdo04932  Non-alcoholic fatty liver disease
mdo04933  AGE-RAGE signaling pathway in diabetic complications
mdo05010  Alzheimer disease
mdo05022  Pathways of neurodegeneration - multiple diseases
mdo05030  Cocaine addiction
mdo05132  Salmonella infection
mdo05133  Pertussis
mdo05134  Legionellosis
mdo05135  Yersinia infection
mdo05140  Leishmaniasis
mdo05142  Chagas disease
mdo05145  Toxoplasmosis
mdo05146  Amoebiasis
mdo05152  Tuberculosis
mdo05160  Hepatitis C
mdo05161  Hepatitis B
mdo05162  Measles
mdo05163  Human cytomegalovirus infection
mdo05164  Influenza A
mdo05165  Human papillomavirus infection
mdo05166  Human T-cell leukemia virus 1 infection
mdo05167  Kaposi sarcoma-associated herpesvirus infection
mdo05168  Herpes simplex virus 1 infection
mdo05169  Epstein-Barr virus infection
mdo05170  Human immunodeficiency virus 1 infection
mdo05200  Pathways in cancer
mdo05202  Transcriptional misregulation in cancer
mdo05203  Viral carcinogenesis
mdo05212  Pancreatic cancer
mdo05215  Prostate cancer
mdo05220  Chronic myeloid leukemia
mdo05221  Acute myeloid leukemia
mdo05222  Small cell lung cancer
mdo05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mdo05321  Inflammatory bowel disease
mdo05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100030053 (RELA)
   04014 Ras signaling pathway
    100030053 (RELA)
   04064 NF-kappa B signaling pathway
    100030053 (RELA)
   04668 TNF signaling pathway
    100030053 (RELA)
   04066 HIF-1 signaling pathway
    100030053 (RELA)
   04071 Sphingolipid signaling pathway
    100030053 (RELA)
   04024 cAMP signaling pathway
    100030053 (RELA)
   04151 PI3K-Akt signaling pathway
    100030053 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100030053 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    100030053 (RELA)
   04218 Cellular senescence
    100030053 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100030053 (RELA)
   04621 NOD-like receptor signaling pathway
    100030053 (RELA)
   04622 RIG-I-like receptor signaling pathway
    100030053 (RELA)
   04623 Cytosolic DNA-sensing pathway
    100030053 (RELA)
   04625 C-type lectin receptor signaling pathway
    100030053 (RELA)
   04660 T cell receptor signaling pathway
    100030053 (RELA)
   04658 Th1 and Th2 cell differentiation
    100030053 (RELA)
   04659 Th17 cell differentiation
    100030053 (RELA)
   04657 IL-17 signaling pathway
    100030053 (RELA)
   04662 B cell receptor signaling pathway
    100030053 (RELA)
   04062 Chemokine signaling pathway
    100030053 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100030053 (RELA)
   04917 Prolactin signaling pathway
    100030053 (RELA)
   04926 Relaxin signaling pathway
    100030053 (RELA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100030053 (RELA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100030053 (RELA)
  09149 Aging
   04211 Longevity regulating pathway
    100030053 (RELA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100030053 (RELA)
   05202 Transcriptional misregulation in cancer
    100030053 (RELA)
   05203 Viral carcinogenesis
    100030053 (RELA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100030053 (RELA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100030053 (RELA)
   05221 Acute myeloid leukemia
    100030053 (RELA)
   05220 Chronic myeloid leukemia
    100030053 (RELA)
   05215 Prostate cancer
    100030053 (RELA)
   05222 Small cell lung cancer
    100030053 (RELA)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100030053 (RELA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100030053 (RELA)
   05022 Pathways of neurodegeneration - multiple diseases
    100030053 (RELA)
  09165 Substance dependence
   05030 Cocaine addiction
    100030053 (RELA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100030053 (RELA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100030053 (RELA)
   04931 Insulin resistance
    100030053 (RELA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100030053 (RELA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100030053 (RELA)
   05135 Yersinia infection
    100030053 (RELA)
   05133 Pertussis
    100030053 (RELA)
   05134 Legionellosis
    100030053 (RELA)
   05152 Tuberculosis
    100030053 (RELA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100030053 (RELA)
   05170 Human immunodeficiency virus 1 infection
    100030053 (RELA)
   05162 Measles
    100030053 (RELA)
   05164 Influenza A
    100030053 (RELA)
   05161 Hepatitis B
    100030053 (RELA)
   05160 Hepatitis C
    100030053 (RELA)
   05168 Herpes simplex virus 1 infection
    100030053 (RELA)
   05163 Human cytomegalovirus infection
    100030053 (RELA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100030053 (RELA)
   05169 Epstein-Barr virus infection
    100030053 (RELA)
   05165 Human papillomavirus infection
    100030053 (RELA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100030053 (RELA)
   05145 Toxoplasmosis
    100030053 (RELA)
   05140 Leishmaniasis
    100030053 (RELA)
   05142 Chagas disease
    100030053 (RELA)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100030053 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mdo03000]
    100030053 (RELA)
Transcription factors [BR:mdo03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    100030053 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 100030053
NCBI-ProteinID: XP_007502748
Ensembl: ENSMODG00000009603
UniProt: F7A8M4
LinkDB
Position
8
AA seq 543 aa
MEGLLPMIFASDSPPARGPFVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKIHGYLGPGTVRISLVTKEPPHRPHPHELVGKDCRDGFYEAELCPDHSIHSFQNLGIQC
VKKRDLEQAIAHRMQTNNNPFNVPLEEQRGDYDLNAVRLCFQVTIQDSAGRPLVLPPVLS
HPIYDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVCFSGPGWEARGSFS
QADVHRQVAIVFRTPPYAEAALQAPVRVHMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTLGTFKNIMKTSPFSGGNPDTWTSPRRIAVPSRTTGSTPKPPGILPGLSSSVPQPY
TFPPPLSTINLEELSPIVFSASQVQAPALASAPTPAPSLVPAPTSTAPAPAPALPPISQS
GEGTLSEALLGLQFDTDGDLAEILADPDSTYTNLAAIDNSEFQQLLNQGIPGTLEGPGPS
GEPMLMEYPESITRLMTGSQRPPEPTPAPPGASGLANGLLGADEVFPSMGDLDISAFLSQ
ISS
NT seq 1632 nt   +upstreamnt  +downstreamnt
atggagggcctgttacccatgatctttgcctcagattcaccccctgcccggggccctttt
gtggagatcattgagcagcctaagcagcgggggatgcgcttccgctacaagtgtgaaggt
cgttccgctggcagcatccctggggagcgcagcacagacaccaccaagacccaccctacc
atcaagatccatggctacttaggaccagggactgtccgcatctccctggtgaccaaggag
cctcctcaccggcctcatcctcatgagttggtggggaaggactgtagggatggtttctat
gaagctgagctctgccctgaccacagcatccacagcttccagaacctggggattcagtgt
gtgaagaagcgagatctggagcaggccattgcccaccgaatgcagaccaacaacaatccc
ttcaatgttcctctggaagaacagcggggagactatgatctgaatgctgtccggctctgc
ttccaagtgaccatccaggactctgcaggaaggcccctcgtcctgccccctgtcctgtcc
catcccatctatgacaaccgggcccccaacaccgcggagctgaagatctgccgtgtgaac
cgtaactcggggagctgcctgggtggggacgagatcttcctcctgtgcgacaaggtgcag
aaagaggacatcgaggtgtgcttctcggggcccggatgggaggcgcgcgggtccttctcg
caggccgacgtgcacaggcaggtggccatcgtgttccgcacaccgccgtatgccgaggcc
gccctacaggccccggtgcgggtccacatgcagctgcggcggccttctgaccgggagctc
agcgagcccatggagttccagtatctgccagacacagacgatcgacacagaattgaagag
aaacgcaagaggacgttgggcacctttaagaacatcatgaagacgagccctttcagtggg
ggcaatcctgacacctggacgtcccccagacgcatcgccgtgccctcccgcaccacaggc
tctactcccaaacctccaggtatccttcctggcctgtcttcctcagtgccccagccctac
accttcccaccacccctcagtaccatcaacctggaggagctttctcccatagtcttttca
gctagccaggtgcaagccccagccctggcctctgcccctacgccggccccctccctggtc
ccagcccccacctcgactgcccctgcccctgcccctgccctgccccctatctcccagtct
ggggaggggacgctgtccgaggccctgctgggcctgcagtttgatacagatggagatctg
gccgagattctggctgaccccgacagcacctacaccaacctggcagccatcgacaattcg
gagttccaacagctgctgaaccaggggataccagggaccctcgaagggcctgggccctca
ggggagcccatgctgatggaataccccgagtccatcacccgccttatgacggggtctcag
cggccccccgagcccaccccagcgcctccgggggcctcggggcttgccaacggtcttcta
ggggcagatgaagtcttcccctccatgggggatttggacatatcagccttcctaagtcag
atcagctcttaa

DBGET integrated database retrieval system