KEGG   Monodelphis domestica (opossum): 100030125Help
Entry
100030125         CDS       T01031                                 

Gene name
GCK
Definition
(RefSeq) glucokinase
  KO
K12407  glucokinase [EC:2.7.1.2]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00010  Glycolysis / Gluconeogenesis
mdo00052  Galactose metabolism
mdo00500  Starch and sucrose metabolism
mdo00520  Amino sugar and nucleotide sugar metabolism
mdo00524  Neomycin, kanamycin and gentamicin biosynthesis
mdo01100  Metabolic pathways
mdo01200  Carbon metabolism
mdo04910  Insulin signaling pathway
mdo04911  Insulin secretion
mdo04917  Prolactin signaling pathway
mdo04922  Glucagon signaling pathway
mdo04930  Type II diabetes mellitus
mdo04950  Maturity onset diabetes of the young
mdo05230  Central carbon metabolism in cancer
Module
mdo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100030125 (GCK)
   00052 Galactose metabolism
    100030125 (GCK)
   00500 Starch and sucrose metabolism
    100030125 (GCK)
   00520 Amino sugar and nucleotide sugar metabolism
    100030125 (GCK)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    100030125 (GCK)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100030125 (GCK)
   04910 Insulin signaling pathway
    100030125 (GCK)
   04922 Glucagon signaling pathway
    100030125 (GCK)
   04917 Prolactin signaling pathway
    100030125 (GCK)
 09160 Human Diseases
  09161 Cancers
   05230 Central carbon metabolism in cancer
    100030125 (GCK)
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100030125 (GCK)
   04950 Maturity onset diabetes of the young
    100030125 (GCK)
Enzymes [BR:mdo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     100030125 (GCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 VIT1
Motif
Other DBs
NCBI-GeneID: 100030125
NCBI-ProteinID: XP_007475913
Ensembl: ENSMODG00000016167
LinkDB All DBs
Position
1
AA seq 532 aa AA seqDB search
MTETQKVNQQRQSIPIQTLVSGTIEKGPHSSVEDDLENFCSETERTTGNSHKWTCPWAAH
LALEAAQMLDYRARMESSKKEKVEQILSEFRLQEEDLKKVMRRMQKEMDRGLRLETHEEA
SVKMLPTYVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEEEEGQWSVKTKHQMYSIPED
AMTGTAEMLFDYISECISDFLDKHHMKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKA
SGAEGNNIVGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDRQCEVGMIVGTGCNAC
YMEEMENVELVEGDEGRMCVNTEWGAFGNAGELDEFLLEYDRVVDETSLNPGQQLYEKII
GGKYMGEIVRLVLMKLVDENLLFNGEASEQLRTRGAFETRFVSQVESDSGDRKQIYNILS
TLGLIPSTTDCDIVRMVCESVSTRAAQMCSAGLAGVINRMRESRSEEVMRITVGVDGSVY
KLHPSFKHRFHATVRQLAPCCDITFIQSEEGSGRGAALVSAVACKKACMLSQ
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaactcaaaaagtaaatcaacagaggcagagcatacctatccagaccctggtc
agtggaaccattgagaaaggacctcattcttcagtggaggacgacttggagaatttttgt
tctgagacagagagaaccactgggaattctcacaagtggacttgtccttgggcagctcac
ctggccctggaagctgcccagatgctggattacagagccaggatggagagctccaagaag
gagaaggtggaacaaatcttgtctgagttcaggctacaggaagaagacctgaagaaagtg
atgaggcggatgcagaaggagatggaccggggcctgaggctggagacccatgaagaagcc
agtgtgaagatgctccccacttacgtgcgctccaccccagaggggtcagaagtgggagac
ttcctttccctggatctgggtggcaccaatttccgggtcatgttggtcaaagtgggagaa
gaagaggagggtcagtggagtgtgaagacaaagcatcagatgtactccatccccgaggat
gccatgacaggcacagcagaaatgctctttgactacatctctgaatgcatttctgatttc
ctggacaaacaccacatgaaacataaaaagttacccctgggcttcacgttctccttcccg
gtgcggcatgaagacattgacaagggaatccttcttaactggacaaaaggcttcaaagca
tcaggcgctgaaggaaataacatagtcgggcttttgagagatgctatcaagcggcgaggg
gactttgagatggacgtcgttgccatggtcaatgacacggtggcaacaatgatttcctgt
tactatgaagatcgccagtgtgaggtcgggatgattgtcggcacagggtgtaatgcctgc
tacatggaggagatggagaatgtggaactggtggaaggcgatgaaggtcgaatgtgtgtg
aacaccgagtggggagcctttgggaatgctggggaacttgacgagttcctgttggagtat
gaccgggtggtagacgagacctccctgaaccccggtcagcagctttatgagaagatcatc
gggggcaagtacatgggggagatcgtaaggctggttctaatgaagctggtggatgagaac
ttgctcttcaatggggaggcatctgaacagctgaggacccggggcgcctttgagacccgt
tttgtctcccaagtagagagtgattctggagaccgaaagcagatctacaatatcctgagt
actctgggcctgataccctccacaacagactgtgatatcgtgcgtatggtctgtgagagt
gtctctactcgggcagcacaaatgtgctcagccgggctggcaggcgtcatcaaccgtatg
agggagagccgaagcgaggaagtcatgaggatcactgtgggtgtagatggctcagtctac
aaactgcaccccagtttcaaacaccgatttcatgccactgtgcggcagctggcaccctgc
tgtgatatcacttttatccagtcagaggagggcagtggacgaggtgctgcccttgtctct
gctgtggcctgcaagaaggcctgcatgcttagccaatga

DBGET integrated database retrieval system