KEGG   Monodelphis domestica (opossum): 100030818Help
Entry
100030818         CDS       T01031                                 

Gene name
GAA
Definition
(RefSeq) glucosidase alpha, acid
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00052  Galactose metabolism
mdo00500  Starch and sucrose metabolism
mdo01100  Metabolic pathways
mdo04142  Lysosome
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100030818 (GAA)
   00500 Starch and sucrose metabolism
    100030818 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    100030818 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mdo04147]
    100030818 (GAA)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100030818 (GAA)
Exosome [BR:mdo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100030818 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 100030818
NCBI-ProteinID: XP_001380232
Ensembl: ENSMODG00000002181
UniProt: F7GEC6
LinkDB All DBs
Position
2
AA seq 954 aa AA seqDB search
MDMEGMPRSWRFNWLIFGGCSVAVLMIFALLGASFLHVSVVIPRESRDISAQQGIYRAEK
EATGKSWAQPHQEFHKNSTGTPLYCNISPDYRFDCAPEKTLTQEQCEARGCCYVPVTQQG
FSQIWTPWCFFPQSYPSYKLENLTTTKTGYTATLTRTVPTFFPKDILTLHLEVHMETESR
LHFTIKDPSNQRYEVPMETPKVNTRAPSPLYSVSFEANPFGLVIFRKSNGMVLLNTTIAP
LFFADQFLQITTSLPSHYITGLGEHQTSLILSTNWTKITFWNRDLPPVPGANLYGSHPFY
LCLEEGGLAHGVFLLNSNAMDVVLQPRPALTWRAIGGILDFYIFLGPEPKSVVQQYLEVI
GYPFMPPYWGLGFHLCRWGYSSTTITRQVVKNMTAANFPLDVQWNDLDYMDAKRDFTFNK
DNFSDFPAMVQEFHQSGRRYVMIVDPAISSTGPPGSYRPYDEGLRRGVFITNETGQPLIG
KVWPGETAFPDFTNPHTRDWWYDIVEEFHTQVPFDGMWIDMNEPSNFVTGSVEGCPNNEL
ENPPYVPGVIGGTLRAVTICASSQQYLSSHYNLHNLYGLTEAIASHDALVRIRGKRPFVI
SRSTFAGHGRYAGHWTGDVSSTWEQLYYSVPEVLLFNLYGVPLVGADICGFVGSTSEELC
VRWTQLGAFYPFMRNHNNKYNQPQEPYVFSEEAQQAMRRAFTLRYMFLPYLYTLFHKAHS
RGETVARPLFLEFPLDSNTWTLDRQFLWGEALLITPVLEVGKIDVNGYFPSGTWYPLMEV
PMEPLIDSSPSSPALQSSVIHSKGQWFTLPAPLEVINIHLRAGYILLLQDPGLTTTESRS
KPMTLIVALTPSGMAKGELFWDDGESLGTLEWGHYTQIMFLANNNVILNDLVQVTSEGTS
LKLRKVTVLGVTTNPKQVFSNGVPIFNFSYNADTQILDIPVSLSVAEQFLISWS
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atggatatggaaggaatgccacgttcctggcgcttcaattggctgatttttggaggatgt
agtgttgctgtcttaatgatatttgctctcttgggggcttcctttctccatgtatcagtt
gtgattccaagagaatccagagacatctcagcacagcaaggcatctatagggctgaaaag
gaggcaacagggaagtcctgggcccagccccatcaggagtttcataaaaactccactgga
actcctttgtattgtaacatctcccctgattaccgctttgactgtgctccagaaaagacc
ctcactcaggagcagtgtgaagcccgaggctgctgctatgttccagtaactcagcaggga
ttctcccaaatatggacgccatggtgcttcttcccacaaagttacccaagctacaaattg
gagaacctcaccaccactaagacaggctacactgcaactctaactcgtacagtacctacc
ttcttccctaaggacatcctaaccctgcatttggaggtgcacatggagacagaaagccga
ctgcattttacaatcaaagatccttccaatcagcggtatgaggttcccatggaaacccct
aaagtcaataccagggctccttctcctctctacagtgtgtcatttgaggccaatcccttt
ggtttggtcatatttaggaagtcaaatggaatggtcttgttaaatacaaccattgctccc
ctgttctttgctgaccagtttctccagattactacctcccttccttcccactatattact
ggccttggggaacaccagacatccctaatactcagcaccaactggaccaagatcaccttc
tggaacagagacctaccacctgtgcctggggccaatctgtatggttcccaccctttctac
ctatgcctggaggaaggaggtttggcccatggggtcttcctactgaacagcaatgccatg
gatgtagtattacagccaagacctgccctgacctggagagcaataggaggcatactggat
ttctacatcttcctggggccagagccaaagagtgtggttcagcagtacttggaagttatt
ggatacccatttatgccaccttactggggtctgggcttccacctgtgccgatggggctac
tcctccaccaccatcactcgacaggtggtaaagaacatgacagcagctaactttcccctc
gatgtccagtggaatgacttagattacatggatgccaagagggactttactttcaacaag
gacaacttctcagattttccagccatggtacaggagtttcatcagagtggccggcgttac
gtcatgattgtggatccagccatcagcagcactggcccccctgggagctacagaccctac
gacgaaggtctgagaagaggagtattcatcaccaatgagacagggcaacctctgattggg
aaggtttggcctggggagacggctttccctgatttcaccaatccacatacccgggattgg
tggtatgacattgtggaggagttccacactcaagtaccctttgatggcatgtggattgac
atgaatgagccatctaactttgttacaggctctgtggaaggttgccccaacaatgagcta
gaaaatcctccctatgtgccaggtgtgattggaggtaccctgagggcagtaaccatttgt
gcctctagccagcaatacttgtcttcccactacaatctgcacaatttgtatgggctgact
gaagccattgcctcccatgatgccttggtgaggattcggggaaagcgtccctttgtgata
tctcgatctacctttgctggccatggccgttatgctggccactggacaggagatgtgtct
agtacctgggagcagttgtactactctgtgccagaggtgctactctttaacttgtatggg
gtacctttggtgggagcagacatctgtggctttgtaggaagtacttcagaggaactgtgt
gtgcgatggacccagctgggagccttctatcctttcatgcggaaccataataacaaatac
aaccagccccaggagccatatgtgttcagtgaagaggcgcagcaagctatgagaagagcc
tttactttgcgctacatgttcctcccctatctctataccctgttccacaaagcccattct
cgtggagagactgtggctcgacctctctttttggagtttcccttggacagtaacacctgg
acactggaccgtcagttcctttggggagaagctctccttattactccagtacttgaagtt
ggcaagatcgacgtgaatggctactttccctcaggcacatggtacccccttatggaggta
ccaatggagcctcttattgactcatcaccttcatctcctgctctccaaagctcggtcatc
cacagcaaaggacagtggttcaccctgcctgcaccactagaagtgatcaatattcacctt
cgggctggttacattcttctactgcaggatcctggattaaccaccacagagtcccgcagt
aaaccaatgaccttgattgtggccttaactccaagtggcatggccaagggggaactgttc
tgggatgatggagagtcccttgggacactggaatggggtcactatacccaaatcatgttc
ttggctaacaataatgttattctcaatgatctggtacaagtgactagtgagggcactagt
ctgaaactgagaaaagtgactgttctaggggtgaccaccaaccccaagcaggtcttctct
aatggtgtcccaatcttcaacttctcctacaacgctgacactcagatcctggacatccct
gtgtcattgtcagtggcagagcagtttcttatcagctggtcctaa

DBGET integrated database retrieval system