KEGG   Monodelphis domestica (opossum): 100031793Help
Entry
100031793         CDS       T01031                                 

Gene name
HK3
Definition
(RefSeq) hexokinase 3
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00010  Glycolysis / Gluconeogenesis
mdo00051  Fructose and mannose metabolism
mdo00052  Galactose metabolism
mdo00500  Starch and sucrose metabolism
mdo00520  Amino sugar and nucleotide sugar metabolism
mdo00524  Neomycin, kanamycin and gentamicin biosynthesis
mdo01100  Metabolic pathways
mdo01200  Carbon metabolism
mdo04066  HIF-1 signaling pathway
mdo04910  Insulin signaling pathway
mdo04930  Type II diabetes mellitus
mdo04973  Carbohydrate digestion and absorption
mdo05230  Central carbon metabolism in cancer
Module
mdo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100031793 (HK3)
   00051 Fructose and mannose metabolism
    100031793 (HK3)
   00052 Galactose metabolism
    100031793 (HK3)
   00500 Starch and sucrose metabolism
    100031793 (HK3)
   00520 Amino sugar and nucleotide sugar metabolism
    100031793 (HK3)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    100031793 (HK3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100031793 (HK3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100031793 (HK3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100031793 (HK3)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    100031793 (HK3)
  09167 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100031793 (HK3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mdo04131]
    100031793 (HK3)
Enzymes [BR:mdo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     100031793 (HK3)
Membrane trafficking [BR:mdo04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    100031793 (HK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 100031793
NCBI-ProteinID: XP_007474180
Ensembl: ENSMODG00000005000
UniProt: F7F731
LinkDB All DBs
Position
1
AA seq 907 aa AA seqDB search
MNEKNLELVQQCLKQFYVTEEQLQQIQAGILRDMEKALSRQTDPSPTVQMLPTYVRSTPH
GTEQGNFLVLELGASGATLRVLWVTLTGTSGPRKEPISREFTIPPEIMLGTGQQLFDFAA
SCLVEFLDQLKVGSQHIQLGFNFSFPCHQTGLDRSTLISWTKGFQCSGVEGQDVVQLLRE
AIQRQGPLLPQGYSIDVVAVVNDTVGTMMSCDPRPQACEIGLVVDTGTNACYMEEARHVG
ELGEDQGRVCVNVQWGSFGDSGALEPVQTPFDLLLDRESLNPGTQRFEKMVGGLYLGELI
RLVLIHLAGQRALFDGATSPALLTHGSVPIEHVMEIEDPSQGRARAQAVLQGLGLNPSSQ
DCQWVQQVCGAVCARAARLCAAALVAILARVEHNQERSQPGIAVATGGRICEQHPRFSTI
LQQTVKLLAPDSDVTFVPSEDGRGRGVAVVTAVASRLALHRRQLEETLAPFRLNSQQLKA
VQVQMQEAMVRGLRGEASSLPMLPTYVCSTPNGTERGDFLALDLGGTNFRVLLVKVGSKS
EGGVKITNQVFSIPESVTQGTGQQLFDHIVDCIVDFQKEHGLVGQILPLGFTFSFPCKQL
GLDQGILLNWTKGFKASDCEGQDVVALLRAAIRRRKGVELNVVAIVNDTVGTMMSCGYED
PRCEVGLIVGTGTNACYMEELCNVSSVPGDQGRMCINMEWGAFGDDGLLKELCTPFDINV
DKSTINPGKQRFEKLISGMYLGEIVRQVLLQLTHLGVLFGGEVSQRLQTKDIFKTKFLSE
IESEGLERRQVRAILGALGLRVNCDDALMVREVCQAVSQRAAGLCGAGVAAVVEKIRENR
GLEELNVAVGVDGTLYKLHPHFSEQVKDTVQRLAPRCSVTFLQSEDGSGKGAALVTAVAC
RLAAGAL
NT seq 2724 nt NT seq  +upstreamnt  +downstreamnt
atgaatgagaagaacctggagttggtgcagcaatgcctgaaacaattctatgtgacagag
gagcagttgcagcagatccaggctggcatcctgagggacatggagaaggccctgagcagg
cagacggacccctctcccactgtccagatgctgcctacctacgttcgatccactccacat
ggcactgagcagggcaatttcctggtgctggagttaggagcctcaggagccactttgagg
gtactgtgggtgacactcacgggcaccagtggcccaagaaaagaaccaataagccgggag
ttcaccatccccccagaaattatgcttggcactggtcaacagctctttgattttgctgct
agctgcttggtggaattcttggaccagctgaaggtgggatctcagcacatccagctgggc
ttcaacttctccttcccctgtcaccagacgggccttgaccggagcacccttatttcctgg
accaagggcttccagtgcagtggtgtagaaggccaggacgtggtacagctgctgagagag
gccatccagagacaggggcctctccttccccagggctacagcatcgatgtggtggctgtc
gtgaacgacacggtgggcaccatgatgagctgtgatcccaggccccaggcttgtgagatt
gggctcgttgtagacacgggcaccaacgcatgctacatggaggaggccaggcacgtagga
gagctgggggaagaccagggccgtgtctgcgtcaacgtgcagtggggttcctttggagac
agtggggccttggaacctgtgcagacgccctttgacctcctactggaccgcgaatccttg
aaccctgggactcaaaggtttgagaagatggttgggggtctgtacctgggagaactcatc
cgcttggtgctgatacacttggccggtcagagggccctctttgatggtgccacctcccct
gccctgctcacccatggctctgtgcccatagagcatgtgatggagatagaggatccttcc
cagggcagggctcgggcccaagctgtgctacaggggctgggcctgaaccccagcagccaa
gactgtcagtgggtacagcaggtgtgtggggctgtgtgtgcccgggctgcccgcctctgt
gccgctgcccttgtggccatccttgcccgagtggagcacaaccaggagagatcccagcca
ggcatagccgtggcaacagggggccgcatttgtgagcagcatcccaggttcagcaccatc
ctgcagcagacagtgaagctcctggctccggattctgatgtcacctttgtcccctcagag
gatggtaggggccggggggtggctgtggtgacagctgtggcctctcgcctggcattacat
cggcgtcagctggaggagaccctggcacccttccgcctcaacagtcagcagctgaaggct
gtgcaggtccaaatgcaggaggctatggtgcgggggctccggggagaggcctcctccctc
cccatgctgcccacctatgtgtgctctacgcccaatggcactgaaaggggagacttcctg
gctctggatcttggaggaactaacttccgggtactcttggtgaaggtgggcagtaaaagc
gaaggaggcgtcaagatcaccaaccaggtcttctccatccccgagagtgtaacccagggg
actgggcagcagctctttgaccacattgtagattgcatagtggacttccagaaggagcat
ggcctggttgggcagattctgcccttgggtttcaccttctccttcccctgcaaacagctt
ggcttggatcagggtatcctcttgaactggaccaagggctttaaggcgtcagactgtgag
ggccaggatgtggtggccctgcttcgagctgccatcagacgcagaaagggagtggagctg
aatgtggtggccattgtcaatgacacagtggggaccatgatgtcttgtgggtatgaggat
ccccgctgcgaggtcggcctcattgtaggaactgggaccaatgcctgttacatggaggag
ctgtgcaacgtgtcttcggtgcctggggaccaaggccgcatgtgtatcaacatggagtgg
ggtgcttttggggatgacggcttgctgaaagagctctgtacacccttcgacattaacgtg
gataaatccaccatcaatcccggcaagcagaggtttgaaaagctgataagtggcatgtat
ctgggggagatcgtgcgccaggtcctcttgcagctgacccacctcggggtcctgttcggt
ggcgaggtgtcccagcgccttcagaccaaggatattttcaagaccaagttcctgtctgag
atcgaaagtgagggtctggagaggcggcaggtccgggctatcctgggtgcgctgggcctg
cgagtgaactgcgacgatgccctgatggtccgggaggtgtgtcaggccgtgtctcagcgg
gccgctgggctctgcggggctggcgtggctgccgtggtggagaagattcgggagaaccgc
ggtttggaggagctgaatgtggccgtgggggtggacggcaccctctacaagctgcacccc
cacttctcggagcaggtgaaggacacggtgcaacgcctggccccgcggtgctccgtcaca
ttcctgcagtcggaggacggttctgggaaaggggccgccctggtcaccgcagttgcttgc
cgtctggctgcgggagccctttag

DBGET integrated database retrieval system