KEGG   Monodelphis domestica (opossum): 100031897
Entry
100031897         CDS       T01031                                 

Gene name
TGFBR2
Definition
(RefSeq) transforming growth factor beta receptor 2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo04010  MAPK signaling pathway
mdo04060  Cytokine-cytokine receptor interaction
mdo04068  FoxO signaling pathway
mdo04144  Endocytosis
mdo04218  Cellular senescence
mdo04350  TGF-beta signaling pathway
mdo04380  Osteoclast differentiation
mdo04390  Hippo signaling pathway
mdo04520  Adherens junction
mdo04659  Th17 cell differentiation
mdo04926  Relaxin signaling pathway
mdo04933  AGE-RAGE signaling pathway in diabetic complications
mdo05142  Chagas disease
mdo05161  Hepatitis B
mdo05166  Human T-cell leukemia virus 1 infection
mdo05200  Pathways in cancer
mdo05202  Transcriptional misregulation in cancer
mdo05210  Colorectal cancer
mdo05212  Pancreatic cancer
mdo05220  Chronic myeloid leukemia
mdo05225  Hepatocellular carcinoma
mdo05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100031897 (TGFBR2)
   04350 TGF-beta signaling pathway
    100031897 (TGFBR2)
   04390 Hippo signaling pathway
    100031897 (TGFBR2)
   04068 FoxO signaling pathway
    100031897 (TGFBR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100031897 (TGFBR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100031897 (TGFBR2)
  09143 Cell growth and death
   04218 Cellular senescence
    100031897 (TGFBR2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100031897 (TGFBR2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100031897 (TGFBR2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100031897 (TGFBR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100031897 (TGFBR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100031897 (TGFBR2)
   05202 Transcriptional misregulation in cancer
    100031897 (TGFBR2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100031897 (TGFBR2)
   05212 Pancreatic cancer
    100031897 (TGFBR2)
   05225 Hepatocellular carcinoma
    100031897 (TGFBR2)
   05226 Gastric cancer
    100031897 (TGFBR2)
   05220 Chronic myeloid leukemia
    100031897 (TGFBR2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100031897 (TGFBR2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100031897 (TGFBR2)
   05161 Hepatitis B
    100031897 (TGFBR2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100031897 (TGFBR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mdo01001]
    100031897 (TGFBR2)
Enzymes [BR:mdo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     100031897 (TGFBR2)
Protein kinases [BR:mdo01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   100031897 (TGFBR2)
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase APH Pkinase_fungal
Other DBs
NCBI-GeneID: 100031897
NCBI-ProteinID: XP_007505277
Ensembl: ENSMODG00000015155
UniProt: F7CFN3
LinkDB
Position
8
AA seq 564 aa
MSRALLWSPGLLLLFLWTRNASTIPPHVQKIVDGVPVTEENGAIKSSLLCKFCDIQPSNC
TNDRSCPSYCGITSICEKAHEICVAVWRKNDKNITIETLCHDPSLEVHGFPLEDSNSDKC
IMREKKVPGETFFMCSCRKEECNDILFFSEDVLDNFDLMAIIFKVTVISLLPPLGIAIAV
IIIFYCYRVHRRRKLSTAWETSKPGKPDYSEGCAMMLDDDRSDISSTCANNLNHNTELLP
IELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFPYEEYASWKTEKEIFSDINLKHEN
ILQFLTAEERKMDLGKQYWLITAFHARGNLQEYLTRHVISWEDLWKLGSSLARGIAHLHS
DHTPCGRPKTAIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLANSGQVGTAR
YMAPEVLESRMNLENMESFKQTDVYSMALVLWEMTSRCNEIGEVKEYEPPFGSKVREHPC
VESMKDNVLRDRGRPEIPNTWLSHRGIQMVCETLAECWDHDPEARLTAQCVAERFDQLGD
LDRLSGRSCSEEKIPEDCSLSPTK
NT seq 1695 nt   +upstreamnt  +downstreamnt
atgagtcgggctctcctgtggagcccggggctactgctcctcttcctgtggacgcgcaat
gccagcaccatccctccccacgtccagaagatcgttgatggagttccagtcacggaggaa
aatggtgccatcaagtcttcactcctttgcaagttttgtgatatccaaccctccaactgc
accaatgataggagctgcccaagttactgtggcatcacatcaatctgtgaaaaggcacac
gaaatctgcgtagctgtgtggaggaagaatgataaaaatattaccatagaaacactctgt
catgatcctagccttgaggtccatggttttcccctggaggattctaattctgataaatgc
ataatgcgggaaaaaaaggtccctggtgagaccttcttcatgtgttcctgtaggaaggag
gaatgcaatgacatcttgttcttctcagaagatgtccttgacaatttcgacctcatggcc
atcatcttcaaagtgactgtcatcagcctccttcccccactgggcatcgccattgccgtg
atcatcatcttctactgttaccgagtccaccgccggagaaagctgagcaccgcctgggag
acgagcaagccagggaagccagactacagcgagggctgtgccatgatgttggatgacgac
cgctcggacatcagctccacgtgcgccaacaacctcaaccacaacaccgagctcctgccc
atcgagctggacacgctggtggggaagggtcgcttcgctgaggtctacaaggccaagctg
aaacagaacacgtccgagcagttcgagacggtggccgtcaagatcttcccctacgaggaa
tacgcctcctggaagacggagaaggaaatcttctccgacatcaacctgaaacacgagaac
atcctccagttcttgacggcggaggagcggaagatggacctggggaagcagtactggctc
atcaccgccttccacgccaggggcaacctgcaagagtatctcactcggcatgtcatcagc
tgggaagacctgtggaagctgggcagctccctggcccggggcattgcccatctccatagc
gaccacacgccctgtgggagacccaaaacggccatcgtgcaccgagacctgaagagctcc
aacatcctggtgaagaacgacctgacctgctgcctctgtgacttcgggctctccctgagg
ttggacccgaccctctctgtggatgacttggctaacagcgggcaggttgggacagcaaga
tatatggctcccgaagttttggaatccagaatgaacttggagaatatggagtctttcaag
caaacagatgtatattccatggcccttgttctctgggaaatgacatctcgctgcaatgag
ataggagaggtcaaggaatatgagccgccatttggttccaaggtgagagagcacccctgc
gttgaaagcatgaaggacaacgtgctgagagaccgaggacggcccgagatcccaaacact
tggctcagtcaccgaggtatccagatggtctgtgagactctggctgaatgctgggaccac
gatccagaggcccgactgaccgctcagtgcgtggccgagcgtttcgaccaactgggggac
ctggaccggctgtcggggagaagctgttcggaggaaaagatccctgaggactgttctctg
agccccaccaaataa

DBGET integrated database retrieval system