KEGG   Monodelphis domestica (opossum): 100032426Help
Entry
100032426         CDS       T01031                                 

Gene name
SOD2
Definition
(RefSeq) superoxide dismutase 2
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo04068  FoxO signaling pathway
mdo04146  Peroxisome
mdo04211  Longevity regulating pathway
mdo04213  Longevity regulating pathway - multiple species
mdo05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100032426 (SOD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100032426 (SOD2)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway - mammal
    100032426 (SOD2)
   04213 Longevity regulating pathway - multiple species
    100032426 (SOD2)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05016 Huntington disease
    100032426 (SOD2)
Enzymes [BR:mdo01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     100032426 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 100032426
NCBI-ProteinID: XP_007484910
Ensembl: ENSMODG00000007521
UniProt: F7GJS0
LinkDB All DBs
Position
2
AA seq 222 aa AA seqDB search
MLCRVMSRRTSKLVPALGCLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHATYVN
NLNATEEKYKEALAKGDVTSQVALQPALRFNGGGHINHTIFWTNLCPNGGGEPKGELMEA
IKRDFGSFEKFKEKLTAVSVGVQGSGWGWLGFNKEQGRLQIAACSNQDPLQGTTGLIPLL
GIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYSACKK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgttgtgccgggtgatgagcaggaggaccagtaagctagtaccggctttgggatgtttg
ggctccaggcaaaagcacagccttcctgatttgccttatgattatggtgcactggagcct
cacattaatgcacagatcatgcaattgcaccacagcaaacatcatgccacttatgtgaat
aacttgaatgctacagaggagaaatataaagaggccttagcaaagggtgatgttacttct
caggtagctctccagcctgcattacggttcaatggtggtggtcatatcaatcatactatt
ttctggacaaatctttgcccaaatggaggaggagaacctaaaggcgaattgatggaagcc
atcaaacgtgattttggttcttttgaaaaatttaaggagaagttgacagctgtgtcagtt
ggtgttcaaggttcaggttggggttggcttggcttcaacaaggagcagggacgactacag
attgcagcttgttccaatcaggatcctttgcaaggaacaacaggtcttattcctcttctg
ggaattgatgtgtgggaacatgcttattaccttcaatataaaaatgttagaccagattat
ctaaaagcaatctggaatgtaattaattgggagaatgtaactgagagatactcagcttgt
aaaaagtaa

DBGET integrated database retrieval system