KEGG   Monodelphis domestica (opossum): 100032853Help
Entry
100032853         CDS       T01031                                 

Gene name
TGM2
Definition
(RefSeq) transglutaminase 2
  KO
K05625  transglutaminase 2 [EC:2.3.2.13]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo05016  Huntington's disease
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    100032853 (TGM2)
Enzymes [BR:mdo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     100032853 (TGM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core A2M_N
Motif
Other DBs
NCBI-GeneID: 100032853
NCBI-ProteinID: XP_007474431
Ensembl: ENSMODG00000000203
UniProt: F6TFD4
LinkDB All DBs
Position
1
AA seq 689 aa AA seqDB search
MTKALVIDKINQDYEKNGKNHRTSALTQDRLVLRRGQSFSISLTFHGRGFEASTDKLFFL
VETGPRPNETVFTKAKFPLSTTHSEGSWEASMVSQEGHTLNLAFSSPANAPIGYYKLSME
SITGSQHHISSITGFVLLFNPWCKEDSVYMEEEEFRQEYVMNQHGLIFQGAPACIEKIPW
NFGQFEDGILDICIELMDMNPKFIRDCGRDCSRRNSPIYVSRVISAMVNCNDDKGILFGR
WDNNYKDGINPMSWIGSVDILKKWKKSGCCQVKYGQCWVFAAVACTVLRCLGIPSRVVTN
YNSAHDSNANLVVDLYTDEKGMTVKHSNESIWNYHCWTESWMTRPDLKPECNGWQVIDPT
PQEKSEGAFCCGPASVNAIKNGDVNTKYDAPFVFAEVNADVVKWIKKSNGTTEKAYTETT
IVGMMISTKAVGKDEREDITHLYKYPENSKEERESFKRANHMNKLGCRDDPSSDEKLKIK
IKVSPDMNKGNDFDVFAMIKNGFSEEQTCHLLIMARTMSYNGILGPECAKKEMHSVTLEP
LSEKKIPLRISYANYRDHLNDSNLIKVQVFLQHLQSQFFFLSERDIYLLNPEIKIRILGE
PKQFRKLVAELSVKNPLHVPLHDCAFTVEGAGLTQGQKIARVPEPVEPGNTVTTRMDLMP
RWPGLHKLVVNFESDKMKAVKGYWNVIIG
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgactaaggcactagtgattgataaaatcaaccaggattatgagaagaatggaaaaaat
caccggacctctgccttgactcaggacagactggtgctcagaaggggccagtcattcagt
atctccctgactttccatggcagaggctttgaagcttctacggacaaactcttcttcctc
gtagagacagggcccagacccaatgagactgtattcaccaaggccaaatttcccctctct
accactcactctgaggggtcctgggaagcctctatggtcagccaagaaggccataccctg
aacctggcattctcctccccagccaatgctcccattggctactacaaactctccatggag
agcatcacgggatcccagcatcatatttcttccatcactggatttgtgcttctcttcaat
ccctggtgcaaagaggattcagtctatatggaggaagaagaatttcggcaggagtatgtc
atgaatcagcacggtctcatcttccagggggccccagcgtgcattgagaagatcccatgg
aactttggacagtttgaagatggaatcttagacatctgcattgaactaatggacatgaac
cccaaattcataagggattgtggtcgtgactgttccaggcgcaatagccctatctacgtt
agtcgggtcatcagtgccatggtcaactgtaatgatgacaagggaattttatttgggcgc
tgggataacaactacaaagatggaatcaaccccatgtcctggataggaagtgtggacatc
ctgaagaagtggaagaagagtggatgttgtcaagtcaaatatggccaatgctgggttttt
gctgctgtagcttgcacagtgttgcggtgcctgggaataccaagcagagtcgtgaccaat
tacaactcagcccatgattcaaatgctaacttggtcgttgacttgtacacagatgagaaa
ggcatgacagtgaagcattctaatgaaagtatatggaactaccactgttggactgaatcc
tggatgacccgtcctgatctaaagccagagtgcaatggttggcaagttattgatccaact
ccccaggaaaagagtgaaggagcattttgttgtggtccagcttcagtcaatgccatcaag
aatggtgatgtgaataccaagtatgatgctcccttcgtctttgctgaagtcaatgcagat
gtggtaaaatggattaagaaaagcaatggaaccactgaaaaggcgtatactgagaccaca
atagtaggcatgatgatcagtacaaaggctgtaggcaaggatgagagagaagacatcact
cacctctacaaatatccagaaaattccaaggaggaacgggaatcatttaaaagagccaat
cacatgaacaagctaggttgcagagatgatccttcatctgatgaaaagctgaagattaag
atcaaagtgtccccagacatgaacaaggggaatgactttgatgtttttgctatgatcaaa
aatggcttttcagaggagcaaacctgccacctactgataatggcccggacaatgagctac
aatggcatactggggcctgagtgtgccaagaaagaaatgcactctgtaaccttggaaccc
ctgtctgagaagaaaatacccctgaggatcagctacgcaaattatagggaccatctgaat
gacagcaaccttatcaaggtgcaggttttcctccaacacctacagtcccagttttttttt
ctgagtgagagagatatctacctgctgaatccagagatcaagatcaggatcctcggagaa
cccaagcagtttcggaagctggtggctgaactgtctgtgaaaaaccccctccatgttccc
ttgcatgactgtgcctttactgtggaaggggctggactgacccaggggcaaaagattgct
cgtgtccctgaaccagtggagcctggaaatactgtcacaacccgaatggacctgatgccc
cggtggccaggattgcacaagttggtggtgaactttgaaagtgacaagatgaaggcagtg
aagggctactggaatgtgattattggataa

DBGET integrated database retrieval system