KEGG   Monodelphis domestica (opossum): 100618101Help
Entry
100618101         CDS       T01031                                 

Gene name
B3GALT4
Definition
(RefSeq) beta-1,3-galactosyltransferase 4
  KO
K00715  ganglioside galactosyltransferase [EC:2.4.1.62]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00604  Glycosphingolipid biosynthesis - ganglio series
mdo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00604 Glycosphingolipid biosynthesis - ganglio series
    100618101 (B3GALT4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mdo01003]
    100618101 (B3GALT4)
Enzymes [BR:mdo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.62  ganglioside galactosyltransferase
     100618101 (B3GALT4)
Glycosyltransferases [BR:mdo01003]
 Glycan extension
  Glycolipid
   100618101 (B3GALT4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Galactosyl_T
Motif
Other DBs
NCBI-GeneID: 100618101
NCBI-ProteinID: XP_003340432
Ensembl: ENSMODG00000023738
UniProt: F6X7H0
LinkDB All DBs
Position
2
AA seq 373 aa AA seqDB search
MHPTMSFCLHPRCILLAAVTFLCIWAIFCPSEIRKELSCTPLMPAPAAPVPPLSLPHLLI
PNIGVCTGLGSPLFLLILVSSAPDHQEQRDAIRASWGALQEIQGYLVRTLFMLGEPSNSP
LENIKEVLKQEAQVKGDIVQAAFMDSYRNLTLKTLSGLAWAAQYCPDVHYVLKTDDDVYI
NVPGLVAELKQRGNDLKKDWQQRYLDRDGTAARSPNLPVPYLYLGHIHRRVYPSRSEYSR
HWVSEVQWPSARGPFPPYGSGTGYVLSAPVLRLILRAAGGVPLIPVEDVFIGVIAKRVGV
IPTHSIRIAGASRYPIDRCCFGRILLTSHHIEPWEMKDIWELVKSSSGNRPLCSWLQEAL
GMLRCWVIHHWHF
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgcaccctaccatgtccttctgccttcacccgcgctgcattctcctggcagctgtgaca
ttcttgtgcatctgggccatcttctgtccctctgagataaggaaggagctctcctgcact
cctctaatgccagctccagctgcacctgtgcccccactctccttgcctcaccttctgatc
cctaacataggagtttgcacaggtcttggttccccacttttccttctgattctggtgagc
tccgcgcctgaccaccaagagcagagagatgccattcgagcctcctggggggctctgcag
gagatccagggctacttggtccggacactcttcatgctgggggaacccagtaacagtcct
ttggaaaacattaaagaagtattgaaacaggaagcacaggttaagggggatattgtgcaa
gctgctttcatggactcctatcgaaaccttactctaaaaactctaagtggactggcatgg
gcagcccagtactgccctgatgtccattacgtcctcaagactgacgatgatgtctacatc
aatgtcccagggcttgtggctgagcttaagcaacgaggaaacgacctgaaaaaggactgg
caacagagatatctcgacagagatggaactgctgcccgtagcccgaatcttcctgtaccc
tacctgtacctaggccatattcatcggagagtctacccttcccggtcggagtacagccgg
cactgggtatcagaggtgcagtggccttctgcccggggtcccttcccaccctatggctca
ggcactggctatgtgttatcagccccagtcctgcggctgattctgagggcagctgggggt
gtgcctctgataccagtagaggatgtctttatcggggtgattgccaagagggtgggggtt
atccccacccacagcatacggatagcaggtgcctcccgctaccccatcgaccgatgctgc
tttgggaggatcttgctaacctctcaccatattgaaccctgggagatgaaggatatctgg
gagcttgtgaagagttcctcagggaataggccactctgctcctggctccaagaagccttg
ggaatgctaagatgttgggtgattcaccactggcatttttga

DBGET integrated database retrieval system