KEGG   Monodelphis domestica (opossum): 100618580Help
Entry
100618580         CDS       T01031                                 

Gene name
SETDB1
Definition
(RefSeq) SET domain bifurcated 1
  KO
K11421  histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00310  Lysine degradation
mdo04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100618580 (SETDB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100618580 (SETDB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mdo03036]
    100618580 (SETDB1)
Enzymes [BR:mdo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100618580 (SETDB1)
Chromosome and associated proteins [BR:mdo03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100618580 (SETDB1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100618580 (SETDB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF5604 SET Tudor_4 TUDOR_5 Pre-SET MBD DUF4537 DUF2680
Motif
Other DBs
NCBI-GeneID: 100618580
NCBI-ProteinID: XP_007485460
Ensembl: ENSMODG00000018821
LinkDB All DBs
Position
2
AA seq 1271 aa AA seqDB search
MTSFPGCFGLGTAAAAGMEPQEIAELQQAVVEELGISMEELRQFIDEELEKMDCVKQRKK
QLAELETWVVQKESEVAHVDQLFDEASRAVTNCESLVKDFYSKLGLQYRESSSEDEASKP
TEVIEIPDEDDDVLSVDSGDAGSRTPKDQKLREAMAALRKSAQDVQKFMDAVNKKTSSQD
LSKGALGQVPIELSKDGDLVVNMRILGKKRTKTWHKGTLIAIQTVGAGRKFKVKFDNKGK
SLLSGNHIAYDYHPPADKLYVGSRVVAKYKDGNQVWLYAGIVAETPNVKNKLRFLIFFDD
GYASYVTQSELYPICRPLKKTWEDIEDISCRDFIEEYITAYPNRPMVLLKSGQLIKTEWE
GTWWKSRVEEVDGSLVKILFLDDKRCEWIYRGSTRLEPMFSMKTSTASTLEKKQGGQLRT
RPNMGAVRSKGPVVQYTQDLTGTGTQFKPLEPPQTTSLPAPTLSPQVTELESLESQLAQA
RKQVAKKSTSFRLGSVGSGHSSPTSPGLSEVVPGGKSGVTQTIRLPPGSATSAPTFPAFH
GMLERAPTEPSYRAPMEKLFYLPHACSHTCLTRVRPVSNAQYRGKNPLLVPLLYDFRRMT
ARRRVNRKMGFHVIYKTPCGLCLRTMNEIERYLFETSCDFLFLEMFCLDPYVLVDRKFQP
YKPFYYILDITHGQEDVPLSCVNEIDTTPPPQVAYSKERIPGKGVFINTGWDFLVGCDCK
DGCRDKSKCACHQLTIQATACTPGGQINPNSGYQHKRLDECLPTGVYECNKRCKCNLNMC
TNRLVQHGLQVRLQLFKTQNKGWGIRCLDDIARGSFVCIYAGKILTDDFADKEGLEMGDE
YFANLDHIESVENFKEGYESDAPCSSDSSGVDLKDQEDGNSGTEDPEESNDDSSDDNFCK
DEDFSTSSVWRSYATRRQTRGQKENGLSETASKDSRPTESGPPHFSAPTSTSVGGCKPPS
SEETPKNKVATWLSCNNISDGSFADSDSRSSFRTSEGGDGKAGGGRGDGEKPSTSGLGVK
EEGDIKPSKKEESDEQNKILLPSEGSRTFGYNPSPVKTEGIKRPPSKTNMHQNRRLMGPA
QPNPDDVLTLSSSTESEGESGTSRKPLAGQTPATAADSDDIQTISSGSDGEDFEDKKNLS
GPVKRQVAVKSTRGFALKSTHGIAIKSTNMASADKGESVPVRKNTRQFYDGEESCYIIDA
KLEGNLGRYLNHSCSPNLFVQNVFVDTHDLRFPWVAFFASKRIRAGTELTWDYNYEVGSV
EGKELLCCCGP
NT seq 3816 nt NT seq  +upstreamnt  +downstreamnt
atgacttcctttcctgggtgttttggtttgggtactgctgcagcagctgggatggaacct
caagagattgctgagctacagcaggctgtggtggaggagctgggtatctccatggaagaa
ctgcgacagtttatcgatgaggaactggaaaagatggactgtgtgaagcagcgcaagaag
cagctagctgagttggagacatgggtggtgcaaaaagagtctgaagttgcccatgttgat
caactctttgatgaagcatccagggcagtgactaattgtgaatctctggtgaaggatttc
tactccaaactggggctgcagtatcgagagagcagttctgaagatgaagcctctaaaccc
acagaagtaattgagattcctgatgaggatgatgatgtcctcagtgttgattcaggtgat
gcaggcagtagaaccccaaaggaccagaagcttcgagaagctatggctgccctgaggaag
tcagctcaggatgtccagaagttcatggatgctgtcaacaagaagactagttcccaggac
ctgagtaaaggagccttgggtcaagtacctattgaactgagtaaggatggtgatctagta
gtcaacatgagaatcctgggcaagaaaaggaccaagacatggcataagggaaccctcatt
gccatccagacagttggggctgggaggaagttcaaagtcaaatttgacaacaaagggaag
agcctattgtctggaaaccatattgcctatgactaccaccctccagcggacaagttgtat
gtgggcagccgtgtggtagccaagtataaggatgggaatcaggtttggctctatgctggc
atcgtggctgagactccaaatgtcaaaaataagctcagattcctcatcttctttgatgat
ggctacgcatcctatgtcacacagtctgagctctatcccatttgtagaccactgaagaag
acgtgggaggacatagaggacatctcatgccgtgatttcattgaagaatatatcactgcc
taccccaaccgtcccatggtgctacttaagagtgggcagctcataaagactgaatgggaa
ggcacttggtggaagtcacgggtggaagaggtggacgggagcctcgtcaagatcctcttc
ctggatgacaagcggtgtgaatggatctatcgaggctcaactcgactggagcccatgttc
agcatgaagacatccactgcttccacactggagaagaagcaagggggacagcttcgaaca
cgcccaaacatgggtgctgtgaggagcaaaggccctgtggtacagtatactcaagatctc
accggtactggaacccagttcaagcccctggaaccacctcagactacctccttgcctgcc
cctaccctgtcccctcaggtgactgagttggaaagtctggaaagtcaactcgcccaggca
cggaagcaagtggccaaaaagagcacatctttccggctaggttctgtgggttctggtcat
tcatcccctacatcccctgggcttagtgaggtggtccctggcgggaagtctggagttacc
cagacaatcagattgccaccgggatctgcaacctctgccccgacatttcctgctttccac
ggtatgctggagcgggctcccaccgagccctcctatcgggccccaatggagaagcttttc
tacttgcctcatgcctgtagccacacctgcctcactcgagttcggccagtgagtaatgct
cagtaccggggcaagaaccccctgctggttcctctgctctatgactttcgaagaatgacg
gcccgacgccgggtcaaccgtaagatgggctttcacgtcatctataagacaccatgtggc
ctctgcctgaggacgatgaatgagattgaacgctacctctttgagacaagctgtgatttt
cttttcttggaaatgttctgtttggacccgtatgttctcgtggatcggaagttccagccc
tataaacctttttactacatcctagacatcacccacgggcaagaggatgttcctctgtca
tgtgtcaatgaaatcgataccaccccaccaccacaggtggcctatagcaaagagaggatc
ccagggaaaggggtcttcatcaacactggctgggatttccttgttggctgtgactgcaaa
gatggttgtcgggacaagtctaaatgtgcttgccaccagctgaccatccaagcaacagcc
tgcaccccaggaggccaaatcaaccctaactctggctaccagcacaagaggctagatgag
tgccttcccacaggggtatatgaatgtaacaagcgctgcaagtgtaacctgaatatgtgc
acaaaccgcttggtgcagcatgggctgcaggtgcgactgcagctattcaagacacagaac
aagggctggggcatccgttgcttggatgacattgccagaggctcctttgtctgtatctat
gcaggcaaaattctaactgatgactttgcagacaaggagggtctagaaatgggggatgaa
tactttgcaaacttggaccatattgaaagtgtggagaactttaaagaaggttatgaaagt
gatgccccctgctcctctgacagcagtggtgtggacttgaaggaccaagaggatggcaac
agtggcactgaggaccctgaagaatccaatgatgacagttcagatgataacttttgcaaa
gatgaggactttagtaccagttcagtatggcgtagctatgccacccggcggcaaacaaga
ggccagaaagaaaatgggttgtctgagacagcctccaaagactcccgacccacagagtct
gggcccccccatttttctgccccaacatcaacttctgtagggggatgtaaacctccttcc
tctgaggagacaccgaagaacaaggtggccacatggctaagctgcaacaatatcagtgat
ggtagctttgccgactcagatagccgatcatccttcaggaccagcgagggtggagatggg
aaggctgggggaggccgtggggatggagagaaaccctccacctcaggactaggggtcaaa
gaagagggagatatcaagccatccaagaaagaggagtctgatgaacagaacaagattttg
ctgcctagtgagggttccaggacttttggctacaatccatcccccgtgaagactgaaggt
atcaagcggccccctagtaagaccaatatgcatcagaaccggaggctcatggggcctgcc
caacccaaccctgatgatgttttgacactgtccagcagcacagaaagtgagggggagagt
gggacaagccgaaagcccctggctggtcagactccagccacagcagctgacagtgatgac
atccagaccatctcatctggctctgatggcgaggattttgaagacaagaagaacctatct
ggcccagtcaaacgtcaggtggcagtgaagtccacacgtggctttgctttaaaatcaaca
catggcattgccatcaagtcaaccaacatggcatccgcagacaagggcgagagcgtgccc
gtccgtaagaatacgcgccagttctatgatggcgaggagtcttgttacattattgatgcc
aagctagaaggcaacctgggccgctatctcaatcacagctgcagtcctaacctgtttgtc
cagaacgtgttcgtcgacacccatgaccttcgtttcccctgggtggctttcttcgccagc
aagaggatacgggctgggacagagctgacctgggactataactacgaggtgggcagcgtg
gaggggaaggagctgctttgctgctgtgggccatag

DBGET integrated database retrieval system