KEGG   Monodelphis domestica (opossum): 103094311
Entry
103094311         CDS       T01031                                 

Gene name
IL3RA
Definition
(RefSeq) interleukin 3 receptor subunit alpha
  KO
K04737  interleukin 3 receptor alpha
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo04060  Cytokine-cytokine receptor interaction
mdo04151  PI3K-Akt signaling pathway
mdo04210  Apoptosis
mdo04630  JAK-STAT signaling pathway
mdo04640  Hematopoietic cell lineage
mdo05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103094311 (IL3RA)
   04151 PI3K-Akt signaling pathway
    103094311 (IL3RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103094311 (IL3RA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103094311 (IL3RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103094311 (IL3RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103094311 (IL3RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mdo04050]
    103094311 (IL3RA)
   04090 CD molecules [BR:mdo04090]
    103094311 (IL3RA)
Cytokine receptors [BR:mdo04050]
 Interleukin receptor families
  IL3 receptor family
   103094311 (IL3RA)
CD molecules [BR:mdo04090]
 Proteins
  103094311 (IL3RA)
SSDB
Motif
Pfam: IL6Ra-bind IL3Ra_N EpoR_lig-bind Cas_Cas6 Tissue_fac
Other DBs
NCBI-GeneID: 103094311
NCBI-ProteinID: XP_007501077
LinkDB
Position
7
AA seq 409 aa
MAEMKTFIWFSMFLTLAYNQAQKQKAPGSPIENITIDVEKMELRWTNVENVKVNNCSIQV
LSKFIYATEATDNKMCHLHGFHPWCHGAEFQINGIAGKSFSKTYHLPQRGKEGTTKEVIT
CHVHEAKFMDCNWTVRKIPRDIHYRFFYSQAGRKVVDKECPQYKTDSKGRNVGCHFDNIS
GFNYFLEHHFLVNGTSNGTEIQCNDAYISLNDIEILTPPNININCRHFSCYMHWNMPKSI
QLSENSFQLEIQKNSEKSFRLITNMTKERNFVFKKVAGKYTVKIRTKNIVGGNWSEWSKP
QEFGYEDPESNPLTFVLLSFLGIAFIMLFIMGYLCKSYLNLQEDKVLGKYPGYHMIHKIF
PPVPHIRDQLNDNFHKYIQVVWEENKILPEQCKIEEIQVIEKKANYPKN
NT seq 1230 nt   +upstreamnt  +downstreamnt
atggcagaaatgaaaaccttcatttggttctcaatgttcctaaccctggcatacaaccaa
gcacagaaacagaaggctccaggttcaccaattgaaaacataactatagacgtggagaaa
atggagctaagatggaccaatgtggagaatgtgaaagtcaacaactgttctattcaagtc
ctctcaaaatttatatatgcaacagaggcaacagacaacaagatgtgccatctccatgga
ttccacccttggtgccatggggcagagtttcaaataaatggaattgctgggaaaagtttt
tcaaaaacataccatcttccccaaagaggtaaagaaggaaccactaaagaagtaataacc
tgccatgttcatgaagcaaaattcatggactgcaactggacagtaaggaaaattccaaga
gacatccattatcgatttttttactcacaagctggaaggaaagttgtggataaagaatgt
ccacagtacaaaacagattctaaaggaagaaatgttgggtgtcattttgataatatctca
ggattcaattactttttggagcatcacttcctagtgaatggaaccagcaatggcacagaa
atccagtgtaatgatgcttacatttcactaaatgatattgaaatacttactccaccaaat
atcaacataaactgcagacattttagttgttacatgcattggaatatgcccaaatcaata
caattatccgagaattcctttcagcttgaaatccaaaagaacagtgagaagagtttccgt
ttgatcactaatatgacaaaagaaagaaattttgtcttcaaaaaggttgctggaaaatat
actgtgaaaataagaactaaaaacattgtaggtggtaattggagtgaatggagtaagccc
caagaatttggttatgaagaccctgaaagcaatcctctgacatttgtattgctgtcattt
cttggaatagccttcattatgctgtttattatgggatatctctgcaaaagctacctaaac
ctacaggaagacaaggttctgggaaaatatccagggtatcacatgattcataaaatattc
cctcctgtcccccatattagagaccaacttaatgacaattttcacaaatacatccaggta
gtctgggaagaaaataaaatacttccagaacaatgtaagattgaagaaatacaagttata
gagaaaaaagcaaactatccaaaaaattaa

DBGET integrated database retrieval system