KEGG   Monodelphis domestica (opossum): 654363Help
Entry
654363            CDS       T01031                                 

Gene name
LDLR
Definition
(RefSeq) low density lipoprotein receptor
  KO
K12473  low-density lipoprotein receptor
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo04144  Endocytosis
mdo04913  Ovarian steroidogenesis
mdo04925  Aldosterone synthesis and secretion
mdo04927  Cortisol synthesis and secretion
mdo04934  Cushing syndrome
mdo04976  Bile secretion
mdo04979  Cholesterol metabolism
mdo05145  Toxoplasmosis
mdo05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    654363 (LDLR)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    654363 (LDLR)
   04925 Aldosterone synthesis and secretion
    654363 (LDLR)
   04927 Cortisol synthesis and secretion
    654363 (LDLR)
  09154 Digestive system
   04976 Bile secretion
    654363 (LDLR)
   04979 Cholesterol metabolism
    654363 (LDLR)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    654363 (LDLR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    654363 (LDLR)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    654363 (LDLR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mdo04131]
    654363 (LDLR)
Membrane trafficking [BR:mdo04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    654363 (LDLR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ldl_recept_a Ldl_recept_b FXa_inhibition cEGF SGL EGF_CA EGF DUF4448
Motif
Other DBs
NCBI-GeneID: 654363
NCBI-ProteinID: XP_001364957
Ensembl: ENSMODG00000006311
UniProt: F7BQZ9
LinkDB All DBs
Position
3
AA seq 906 aa AA seqDB search
MHFPYRRAKSRLGFRTKFKALLEPTVGLGHNRSRGKDSKPKGIEGSMKGLRSLDILLCSG
IIIVLTLSTATNAVDTCGRNEFQCQDGKCISYKWVCDGSPECKDGSDETMETCLSVTCKP
EEFSCGGRVNRCIPLTWKCDSQTDCENGSDEQDCPLKTCSHDQFRCHDGKCISQEFVCDA
DRDCNDGSDELDCPDPTCNPATFQCNSTQCIPKLWVCDGDQDCEDGSDEWPDKCGEQDLV
KKPKPCSSLEFHCGSGECIHMSWRCDGGHDCKDKSDEEGCVKATCRPDEFQCNDGECVHG
SRQCNKEYDCKDMSDEIGCVNVTLCEGPNKFKCHSGECISMDKVCNGPRDCRDWSDEPIK
ECGTNECLNNKGGCSHICNDLKIGYECLCPEGFRLIDQKRCEDIDECQNPDTCSQFCVNL
PGSYKCECYEGYQIDPITKTCKAIGTIAYLFFTNRHEVRKMTLDRSEYISLIPNLKNVVA
LDMEVASNKIYWSDLSQKKIYSSEIDSAHSLSTHDTVISGDIQAPDGIAVDWIHGNLYWT
DSVLGTISVANTKGSKRKTLFKQEGAKPRAIVVDPVHGFMYWTDWGTPAKIGKGGLNGVD
SFSLVTEAIEWPNGITLDLSSDRLYWVDSKLHSISSVDVNGGNRRIVLEDKNKLAHPFSL
AIFEDKVFWTDIINEAIFSANRLTGSDIILVAEDLLSPEDIVLYHNLTQPTGVNWCEKTS
LSNGGCQYLCLPAPQINSHSPKFTCACPDGMNLAADMRTCIKEAIVPVTSSKPIATKEPK
MTTLAGLVTAITRKPTIKHGTPDLTTAEMVTMSQKAVLNQMGIQESQEHHNGPTALSIVL
PIVLLILIAFGAFLVWKNWRLKNINSINFDNPVYQKTTEDEVHICRSQDGYTYPSRQIVS
LEDDIA
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
atgcatttcccatatagacgtgctaagtcacgcctgggtttccgcacaaaatttaaagcc
ctgttagaaccaacagttggcctcggacacaatagaagccgggggaaagatagcaagcct
aaagggatagaaggaagcatgaaaggcttaaggtctttagatatattgctgtgttcagga
atcattatcgttctgactttatctaccgcaacgaatgcagtggacacatgtgggaggaat
gaattccagtgccaagatggaaagtgcatctcctataagtgggtctgtgatgggagtcct
gagtgcaaggatggatctgatgaaaccatggaaacctgcttatctgtgacctgcaagcca
gaggagttcagctgtggtggtcgagttaatcggtgcatccccttaacctggaagtgtgac
tcccaaacggactgtgagaacggttcagatgagcaggattgccccctgaagacatgttcc
catgaccagttccgatgccatgatgggaagtgcatctcccaagagtttgtctgtgatgca
gatagggactgtaacgatgggagtgatgagctagattgtccagaccccacctgcaatcca
gcaacattccagtgcaacagtactcagtgtatccccaaactatgggtctgcgatggggac
caggactgtgaagatggctctgatgaatggcctgacaagtgcggggaacaggacttggtc
aagaagcccaagccttgctcttctctggagttccactgtggcagtggggagtgcatccat
atgagttggcggtgcgatgggggtcatgactgcaaggacaaatctgatgaggagggctgt
gtcaaagccacctgccgccctgatgagtttcagtgcaatgatggggaatgtgtccacggg
agccggcaatgcaacaaggaatatgattgcaaggatatgagtgatgagatcggctgtgtc
aatgtaacactgtgcgagggcccgaacaaatttaagtgccatagtggagagtgcatctct
atggataaagtgtgtaatggacccagagactgccgggactggtctgatgagccaatcaag
gagtgtggaaccaatgaatgtctgaacaacaaaggcggctgctctcatatatgcaacgac
ctcaaaatagggtatgaatgcctgtgccctgaaggcttccgactcattgaccagaaaaga
tgcgaagatatcgatgaatgccagaacccagacacttgcagccagttttgtgtgaatctc
ccaggaagttacaagtgtgaatgttatgaaggttaccagatcgacccgatcactaagacc
tgcaaggccattggcaccattgcctatctctttttcaccaaccgccatgaagtgaggaag
atgactttggaccgaagtgaatacatcagtctcattccaaatctgaaaaatgtagtagcc
ttggacatggaagtggccagcaataagatctattggtctgatctgtcacagaagaagatc
tatagctccgaaattgacagtgcccatagtctctccactcatgatactgtgatcagtgga
gatatccaggctccagatggcattgcagttgactggatccatgggaatctctactggaca
gactctgtccttggcaccatttctgtggccaacactaagggctccaagaggaagacactt
ttcaaacaggaaggtgctaaaccccgggccatcgtggtagatccagttcatggcttcatg
tattggacagactggggaacccctgctaagattgggaaaggtggtctgaatggagttgac
agtttttccctggtgacggaagcgatagaatggcccaatggaatcactcttgatctgtcc
agtgatcgtctctactgggttgactccaagcttcactccatctccagcgtggatgtcaat
ggtggaaacaggaggatagtgttagaggataaaaacaaacttgcacacccattttccctg
gcaatttttgaggataaggtcttctggacagatatcataaatgaagccattttcagtgca
aatcgcctcaccggatctgatattattttggtggcagaagatctcttgtctcctgaggac
attgtcctctatcacaacctcacccagcctacaggggttaactggtgtgagaagacttct
ctctccaatggtggctgccagtatctgtgccttccagccccacaaatcaactctcactcc
cccaaattcacctgtgcctgtcctgatggcatgaacctagctgcagatatgcgaacgtgt
atcaaagaagcaattgtacctgttacttcttccaagcccattgcaacaaaggagcctaaa
atgactactcttgcgggcttagtaacagccattacacggaagccgaccatcaagcatggc
actcctgacctcacgacggcagaaatggttacaatgtcccaaaaagcagtactgaatcaa
atgggtatacaagagagtcaagagcaccataatggacccacggcattatccattgtttta
ccaatagttctgctcattttgattgcctttggagcattcctggtatggaagaactggagg
ctcaagaacatcaacagcataaactttgataatcccgtttatcaaaagaccacagaagat
gaagttcacatctgtaggagtcaagatggctacacatatccctcgagacagatagtgagc
ctggaagatgatattgcatga

DBGET integrated database retrieval system