KEGG   Monodelphis domestica (opossum): 751078Help
Entry
751078            CDS       T01031                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase complex iron sulfur subunit B
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00020  Citrate cycle (TCA cycle)
mdo00190  Oxidative phosphorylation
mdo01100  Metabolic pathways
mdo01200  Carbon metabolism
mdo04714  Thermogenesis
mdo04932  Non-alcoholic fatty liver disease (NAFLD)
mdo05010  Alzheimer disease
mdo05012  Parkinson disease
mdo05016  Huntington disease
Module
mdo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mdo_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    751078 (SDHB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    751078 (SDHB)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    751078 (SDHB)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    751078 (SDHB)
   05012 Parkinson disease
    751078 (SDHB)
   05016 Huntington disease
    751078 (SDHB)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    751078 (SDHB)
Enzymes [BR:mdo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     751078 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_18 Fer4_7
Motif
Other DBs
NCBI-GeneID: 751078
NCBI-ProteinID: XP_003341083
Ensembl: ENSMODG00000002770
UniProt: F6YGR0
LinkDB All DBs
Position
4
AA seq 282 aa AA seqDB search
MAAALGVSLSRGHLLGVALLPRIRVQACRGAQTAATAAPRLKKFAIYRWDPDKTGDKPRM
QTYEVDLNKCGPMVLDALIKIKNEVDATLTFRRSCREGICGSCAMNINGGNTLACTRRID
TNLNKVSKIYPLPHMYVMKDLVPDLNNFYAQYKSIQPYLKKKDESQEGKAQYLQSMEDRE
KLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAQLQDPF
SLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKKSTA
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgcgttgggagtctccttgagccgcgggcacctcctgggagtcgctctgctg
cccaggatccgggtgcaggcctgccggggggcccagactgcagccactgcagctccccgc
ctcaagaaatttgccatctacagatgggacccagacaagactggagacaagccccgaatg
caaacatatgaagttgatctgaataaatgtggcccaatggtgttagatgccttgatcaag
attaaaaatgaggtggacgctacactaactttccggagatcatgccgggaaggcatctgt
ggttcctgtgcaatgaatatcaatggaggcaacacactggcttgcaccagaaggattgac
accaacctcaacaaagtctctaaaatctaccctcttccccatatgtacgtgatgaaggat
cttgttccggatttgaataacttctatgctcagtacaaatctattcagccttacttgaag
aagaaggatgaatcccaagagggcaaggcgcagtacttgcaatccatggaagatcgagag
aaactggatggactctacgagtgcattctctgtgcctgctgcagcaccagctgccctagt
tactggtggaacggagacaaatatctggggcctgcagtcctcatgcaggcctatcgctgg
atgattgactccagagatgacttcacagaggagcgactggcacagctccaagaccccttc
tctttgtaccgatgtcacaccatcatgaactgcaccaggacctgccctaagggactgaat
ccaggaaaagcaatagctgaaatcaagaagatgatggcgacctacaaagagaagaaatct
actgcttag

DBGET integrated database retrieval system