KEGG   Monodelphis domestica (opossum): 751085Help
Entry
751085            CDS       T01031                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase complex flavoprotein subunit A
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00020  Citrate cycle (TCA cycle)
mdo00190  Oxidative phosphorylation
mdo01100  Metabolic pathways
mdo01200  Carbon metabolism
mdo04714  Thermogenesis
mdo04932  Non-alcoholic fatty liver disease (NAFLD)
mdo05010  Alzheimer disease
mdo05012  Parkinson disease
mdo05016  Huntington disease
Module
mdo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mdo_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    751085 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    751085 (SDHA)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    751085 (SDHA)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    751085 (SDHA)
   05012 Parkinson disease
    751085 (SDHA)
   05016 Huntington disease
    751085 (SDHA)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    751085 (SDHA)
Enzymes [BR:mdo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     751085 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 751085
NCBI-ProteinID: XP_007486821
Ensembl: ENSMODG00000000624
LinkDB All DBs
Position
3
AA seq 665 aa AA seqDB search
MSGVSVAARLLVRRRLALTRSQWPIAFHSNTRSFHFTVSGEKRSSAKVSNSISTQYPVVD
HEFDALVVGAGGAGLRAAFGLSEAGFNTACITKLFPTRSHTVAAQGGINAALGNMEEDNW
RWHFYDTVKGSDWLGDQDAIHYMTEQAPASVIELENYGMPFSRTEEGKIYQRAFGGQSLK
FGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMEDGECRGVIALCI
EDGSIHRIRAKNTVIATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHPTG
IYGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTIEIREGRGCGP
EKDHVYLQLHHLPPEQLSTRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKG
QVLTHVNGRDQVVPGLYACGEAASASVHGANRLGANSLLDLVVFGRACALSIAETCKPGD
KVPQIKANAGEESVANLDKLRFASGDIRTSELRLNMQKSMQNHAAVFRVGSVLQEGCQIL
SQLYNDLKNLKTFDRGMVWNTDLVETLELQNLMLCALQTIHGAEARKESRGAHAREDYKV
RIDEYDYSKPIEGQRKKPFEEHWRKHTLSYVDVKTGKVSLEYRPVIDKTLNEADCATVPP
AIRSY
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgtccggtgttagtgtagctgcgcggctgctggtccgtcggaggctggctctgacacga
tcgcaatggccgatagctttccattccaatacacgaagctttcactttactgtcagtgga
gaaaaaagatcatcagctaaagtttcaaattcaatttccacacagtatcctgtagtagac
catgaatttgatgcattggtggtgggtgctggtggggcaggtttacgagctgcttttgga
ctttctgaagctgggttcaatacagcatgtattacaaagcttttccccaccaggtcacat
actgttgcagcacagggaggaatcaatgctgctttggggaatatggaggaagacaactgg
agatggcatttctacgacactgtgaaaggttctgattggttgggtgatcaggatgcaatt
cattacatgactgagcaagcacctgcttcagtaattgagttggaaaattatggaatgcca
tttagtagaacagaagaaggaaagatttatcagcgagcatttggtggacagagccttaag
tttgggaaaggaggacaggctcatcgatgctgttgtgtggcagataggacaggccattcc
ttgttgcacactctgtatggaaggtctctgaggtatgataccagctattttgtagaatat
tttgccttggatctcttgatggaagatggggagtgccgaggagtaattgcattatgcata
gaagatggatctattcatcgtataagagcaaaaaatacagttattgcaactgggggttat
gggcgcacttatttcagctgtacttctgctcatactagcacaggagatggcacagcaatg
gttacacgagcaggccttccttgtcaagacttagagtttgtacaattccatcccacaggc
atatatggggctggctgtcttattacagaaggatgccgtggtgaaggaggcattcttatt
aatagtcaaggtgaaagatttatggaaagatatgcacctgttgcgaaagatctagcgtcc
agggatgttgtatctcgttctatgaccattgaaatacgtgaaggaagaggctgtggtcct
gaaaaagaccatgtatatctacagttacaccacctaccccctgaacagctatctactcgc
ctccctggaatatcagaaactgcaatgatatttgctggtgtggatgtcaccaaggaacca
atccctgttctccctactgtgcattataatatgggaggcattcctacaaattataagggg
caggttcttacacatgtgaatggtagagatcaagttgtacctggtctctatgcttgtggt
gaagcagcctctgcatcagtacatggtgctaatcgactaggagctaattctcttctggac
ttggttgtctttggtcgtgcttgtgccctgagcattgcagaaacatgcaaacctggtgat
aaagtcccccaaattaaagcaaatgccggggaagaatctgttgcaaatcttgacaaattg
cgttttgcttccggagacataagaacatcagaactaaggctcaacatgcaaaagtctatg
cagaaccatgcagctgtgttccgtgtgggaagtgtgctacaggaaggctgccagatatta
agccagctctacaatgacttaaagaatctaaagacatttgacagagggatggtgtggaat
actgatctggtagaaaccttagaattgcagaatctaatgttgtgcgctctgcaaactatt
catggtgctgaggctcgtaaagagtcacgtggagctcatgccagagaagactacaaggta
agaattgatgagtatgattattccaagccaattgagggacaacgaaagaaaccatttgaa
gaacactggagaaagcacacactttcttatgtagatgtcaaaactggaaaggtttctttg
gaatatagacctgtaatcgacaaaactttgaatgaagctgactgtgccacagttccacct
gctattcgctcttattga

DBGET integrated database retrieval system