KEGG   Mycolicibacterium duvalii: MDUV_02710
Entry
MDUV_02710        CDS       T06492                                 

Definition
(GenBank) aspartate aminotransferase family protein
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
mdu  Mycolicibacterium duvalii
Pathway
mdu00250  Alanine, aspartate and glutamate metabolism
mdu00410  beta-Alanine metabolism
mdu00640  Propanoate metabolism
mdu00650  Butanoate metabolism
mdu01100  Metabolic pathways
mdu01120  Microbial metabolism in diverse environments
Module
mdu_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mdu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MDUV_02710
   00650 Butanoate metabolism
    MDUV_02710
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MDUV_02710
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MDUV_02710
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mdu01007]
    MDUV_02710
Enzymes [BR:mdu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     MDUV_02710
Amino acid related enzymes [BR:mdu01007]
 Aminotransferase (transaminase)
  Class III
   MDUV_02710
SSDB
Motif
Pfam: Aminotran_3
Other DBs
NCBI-ProteinID: BBX15411
LinkDB
Position
complement(259239..260498)
AA seq 419 aa
MTALSPVLKQATDVLAARGVGVELFDEDNRRYLDFTAGIGVTSTGHCHPRVVEAAQRQVG
SLIHAQYTTVMHRPLLDLVDRLGEVLPPGLDRVFFANSGSEAVEAALRLARQATGRPNVV
VFHGGFHGRTVAAASMTTSGTKFRSGFAPMMAGVHVAPFPDPTHYGWPVEQATDFALAQL
DYLLQTMTAPADTAAFVVEPVLGEGGYVPANTRFLAGLRERADRHGILLVVDEVQTGFGR
TGKFWGHDHFTSDAFVAPDVLITAKGLASGFPLSAIAASADVMGRAWPGSQGGTYGGNAV
ACAAALATLDVIRDEKLVDNAAARGEQLRHGLQLVADKHDAITDVRGLGLMLGNEFRDAA
GKPDGAAAAAAQREAARRGLLLLTCGAWGQVVRFIPALVVDADHIDEALGLWGDAVAAL
NT seq 1260 nt   +upstreamnt  +downstreamnt
gtgaccgcactttcgcccgtcctcaagcaagcgaccgacgtcctggccgcgcgcggcgtc
ggcgtcgagctcttcgacgaggacaaccgacgctatctcgatttcaccgccggaatcggc
gtcaccagcaccgggcattgtcatccccgcgtcgtcgaggccgcccagcgccaggtcggc
tccctgatccacgcgcagtacaccaccgtgatgcaccgcccactgctcgacctggtggac
cgcctgggcgaggtactgccccccggcctggaccgggtgttcttcgcaaactccggcagc
gaggccgtcgaggccgcactgcgtctcgcgcgacaggccaccgggcggcccaacgtggtg
gtcttccacggcggtttccacggccgcacggtcgccgcggcgtcgatgaccacctcggga
accaagttccggtccggtttcgcgccgatgatggccggcgtccatgtcgcaccgtttccc
gaccccacccactacggctggcccgtcgaacaggccaccgacttcgcgctcgcgcagctg
gactatctgctgcagaccatgaccgcgcccgccgacaccgccgcgttcgtcgtcgagccg
gtgctcggcgagggcggttacgtgcccgccaacacccgcttcctggccgggctgcgcgag
cgcgccgaccggcacggcatcctgctggtcgtcgacgaggtgcagaccggcttcggtcgc
accgggaagttctgggggcacgaccatttcacgtccgacgcattcgtcgcgcccgatgtc
ctgatcaccgccaaagggttggcctcgggcttcccgttgtcggcgatcgccgcatcggcc
gacgtcatgggccgggcgtggccgggttcgcagggcggcacctacggcggcaacgcggtg
gcctgcgcagcggcgctggccaccctcgacgtcatccgcgacgagaagctggtcgacaac
gccgccgcacgcggcgaacagttacgccacgggctacagctggtcgccgacaaacacgac
gcgatcaccgatgtgcggggtctgggcctgatgttgggcaacgagttccgcgacgccgca
ggtaaacccgacggtgccgcggcggcggcggcgcagcgggaggccgcccggcgcggcctg
ctgctgctgacctgcggcgcgtggggccaggtggtgcgcttcattccggcgctcgtcgtc
gacgccgatcacatcgacgaggctctcggcctgtggggcgatgccgtcgccgccctgtga

DBGET integrated database retrieval system