KEGG   Mogibacterium diversum: C5Q96_02760Help
Entry
C5Q96_02760       CDS       T05355                                 

Definition
(GenBank) hypothetical protein
  KO
K07009  lipid II isoglutaminyl synthase (glutamine-hydrolysing) [EC:6.3.5.13]
Organism
mdv  Mogibacterium diversum
Pathway
mdv00550  Peptidoglycan biosynthesis
mdv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdv00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    C5Q96_02760
Enzymes [BR:mdv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.13  lipid II isoglutaminyl synthase (glutamine-hydrolysing)
     C5Q96_02760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AVM47831
UniProt: A0A2S0L3F6
LinkDB All DBs
Position
complement(592919..593638)
Genome map
AA seq 239 aa AA seqDB search
MIIEMLYPELSNLYGDSANIKYLKDSFPEIEIIETNIGERPTFLNKGKVDLVYRGTMTER
GQQLFIDNASMYVDEMKDAIEQGQRFLVTGNAVEVFGKYIIDKTGEKIDCLKVFNYHTER
DILAKRFNSLYVGMYNDIKIVGFKSQFGHSFYDDEIEPLFDTIRGPGFNSKETREGIHYK
NFMGTYLLGPLLILNPDFTIDFANEIGMSEFKPAFYDTAKAAYEMRLKQYTDDKTGFYY
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgattatcgaaatgctttatccagagctcagtaacttatatggagactccgccaatatt
aagtatcttaaggattcttttccagagattgaaataatagaaacaaatattggtgagcgt
cccacttttttaaacaagggtaaagtcgaccttgtatacagaggaaccatgactgaacgc
ggtcagcagctttttatagataatgcatcaatgtatgtcgacgaaatgaaagatgctata
gagcaagggcagcgttttttagttactggcaatgctgttgaggtttttggtaaatatata
attgataagacaggggaaaagattgactgtcttaaagtttttaattatcacactgagaga
gatattctagccaaacgttttaattcactctatgtcggtatgtataatgatattaagata
gttggatttaaaagccaatttggtcatagtttctatgatgatgaaattgaaccacttttt
gataccattagaggacctggatttaacagtaaagaaacacgtgagggtattcattataaa
aattttatgggcacgtatttacttggtccattactgattctcaatccggattttacaatt
gattttgctaatgaaattggcatgtctgaatttaagcctgcattttacgatacagctaaa
gctgcttacgagatgaggcttaagcagtacacagatgataagacaggtttttattactag

DBGET integrated database retrieval system