KEGG   Mogibacterium diversum: C5Q96_07375Help
Entry
C5Q96_07375       CDS       T05355                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mdv  Mogibacterium diversum
Pathway
mdv00473  D-Alanine metabolism
mdv00550  Peptidoglycan biosynthesis
mdv01100  Metabolic pathways
mdv01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mdv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    C5Q96_07375
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    C5Q96_07375
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    C5Q96_07375
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mdv01011]
    C5Q96_07375
Enzymes [BR:mdv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     C5Q96_07375
Peptidoglycan biosynthesis and degradation proteins [BR:mdv01011]
 Precursor biosynthesis
  Amino acid ligase
   C5Q96_07375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_3 CPSase_L_D2 ATP-grasp_4 TTL
Motif
Other DBs
NCBI-ProteinID: AVM48682
UniProt: A0A2S0L5Y0
LinkDB All DBs
Position
complement(1531600..1532682)
Genome map
AA seq 360 aa AA seqDB search
MNIAVIFGGRSDEHEVSRSSAVNVIKGLDSDRYEITKIGITKEGRWYLTEASTGEIASGA
WENRPDNRQACIPADPTVHGILVFDEEDRATAKRIDCIIPVLHGDNGEDGTVQGLFELAE
IPYVGPGVKASANGMDKSVTKIIVGETGITQAKYCVIKKKDFADDREGEIMNALSTNDGK
LPLFVKPSSAGSSVGASKVEKKSELEGAIENAFKYDDKVLVEEMIVGREMEVAVLGNHNP
KASCVGEILSAGEFYDYDAKYNNPESQTRVVDDIPMSKQKEIRNSAVEIFKVMDCRGLSR
VDFFYTEDGRVVFNEINTLPGFTNISMYPQLWEAMGIDQPTLLDSLIKLAIEEHTYDEKY
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaatattgcagttatatttggaggaaggtccgatgagcatgaggtgtcgcgaagttca
gcggtaaatgtcatcaaggggctcgattctgaccgctacgaaattactaaaattggaata
accaaagagggcagatggtatctgaccgaggcaagtacaggcgaaatcgctagcggtgct
tgggaaaatagacctgataacagacaggcgtgcatccctgcggatccgacggtacacgga
atcctcgttttcgacgaagaggatagagcgaccgcaaagcgtatagactgcatcatacca
gtgctccacggagacaacggagaagacggaacagtacagggcctctttgagctcgctgag
attccttacgttggtcctggcgtaaaggcttctgcaaatggaatggataaatcagttacc
aagatcatcgtgggcgagactggcatcactcaggcgaagtactgcgtgattaagaagaag
gattttgccgatgaccgtgagggcgaaatcatgaatgctcttagcacgaatgacggaaag
ctaccgctgttcgttaagccatcttcggcgggatcctcggttggagcttccaaagtcgag
aagaagtcggagctcgaaggggctattgaaaatgcatttaagtatgatgacaaagtcctc
gtcgaagagatgattgtcggtagagagatggaagttgcggttctcggcaatcacaatccg
aaggcttcttgcgtgggtgagattctatcagctggtgaattctatgattacgatgcgaag
tacaacaaccctgaatcacagacgagagttgtcgacgatatcccgatgagcaagcagaag
gagattagaaatagcgccgttgaaatattcaaggtgatggactgccgcggactatcgagg
gttgacttcttctatactgaagacggcagagttgtatttaatgagattaatacgctgcca
ggatttacgaatatcagcatgtatccacagctgtgggaagcgatgggcatagatcagcca
accctgctagacagtttgattaagctggcgattgaagagcatacgtatgatgagaaatat
taa

DBGET integrated database retrieval system