KEGG   Mogibacterium diversum: C5Q96_07515Help
Entry
C5Q96_07515       CDS       T05355                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mdv  Mogibacterium diversum
Pathway
mdv00250  Alanine, aspartate and glutamate metabolism
mdv00430  Taurine and hypotaurine metabolism
mdv00650  Butanoate metabolism
mdv01100  Metabolic pathways
mdv01110  Biosynthesis of secondary metabolites
mdv01120  Microbial metabolism in diverse environments
mdv02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:mdv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    C5Q96_07515
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    C5Q96_07515
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C5Q96_07515
   00430 Taurine and hypotaurine metabolism
    C5Q96_07515
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    C5Q96_07515
Enzymes [BR:mdv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     C5Q96_07515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Amidase_3
Motif
Other DBs
NCBI-ProteinID: AVM48968
UniProt: A0A2S0L6Q9
LinkDB All DBs
Position
1566209..1567687
Genome map
AA seq 492 aa AA seqDB search
MKRGTEMRNSENNEVKLNDSLSSLNDDTGYRTPIFGTETSGAAMPKDKINDEPVAPGVAA
EMIRQYLSVEGNATQNLATFCQTYMEPEATKLMAENFEKNAIDKDEYPMTADLENRCVDI
IGKLWNVDKKEEPLGTSTVGSSEACMLGGLAMLFRWKKLADAAGVDRFTKRRPNLVISSA
YQVCWEKFCRYWDIEMRTVPIDLDHLSLNMDTVMDYVDEYTIGIVAILGITYTGKYDDVK
ALDNLVEKYNKEHADMPIRIHVDAASGGMVAPFIDSELEWDFRLKNVWSISTSGHKYGLV
YPGVGWVIWRSKEALPEELIFWVSYLGGKEATMAINFSRSASQIVGQYYMLLRNGFKGYK
EIHERTLEVARYMASEIEKMGIFEVLEGAEQIPIICWKLKDDVKVEWTLYDLADRLRMQG
WMVPAYPMPENIKDIDVQRLVLRQDFGMNLAILCINDMKKQIEILNNSRVIVPNNENGDN
NYVSKGFDHSGR
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaggtacggaaatgagaaattcggaaaataacgaagtaaaactgaatgatagt
ctatcttctttgaatgatgatacgggttaccgcacacctattttcggtacagagactagc
ggtgctgcaatgccaaaggataagataaatgatgagccagttgctccaggagtggctgca
gagatgatcagacagtatctgagtgttgagggtaatgcgactcagaatcttgcgacattc
tgccagacatatatggaaccagaagcaacaaagcttatggcagagaatttcgagaaaaat
gcgattgataaggatgaatatcctatgacagcagaccttgaaaatcgctgcgtagatatt
attggaaagctatggaatgtagataaaaaggaagagccactcggaacttccacggttggc
tcatctgaagcgtgcatgctcggcggactagcaatgttatttagatggaaaaagctagca
gatgcagctggtgtagatagatttaccaagagaagacctaatctcgtaatctcatcagct
tatcaggtgtgctgggaaaagttctgccgctactgggatatcgagatgagaactgtgcca
atcgaccttgatcatctatctcttaacatggatacggttatggattatgtcgatgaatac
actatcggaatagtagcgatactgggcataacctatactggaaagtacgatgatgttaag
gcactcgataaccttgttgagaaatacaataaagagcatgccgatatgccaatccgtatt
cacgtagatgcagcttccggcggtatggttgctccatttatcgattcagaactagagtgg
gatttcaggctcaagaatgtgtggtcgataagcacatctggacataagtacggactcgta
tatccaggagttggctgggtaatttggcgcagcaaggaagctctccctgaggaattaata
ttctgggtaagctatctcggtggcaaggaagcaactatggcgattaacttctctcgtagc
gcttcgcaaatcgtcggacagtattatatgctgcttagaaatggatttaagggatacaaa
gaaatccatgagcggaccctagaggttgctagatacatggcttccgagattgagaagatg
ggaatctttgaagtgcttgagggcgcagaacagattccaatcatctgctggaagctcaag
gacgacgtaaaggtggagtggacactatatgatctggcagatcgtctccgtatgcagggc
tggatggtgcctgcatatccaatgccagagaatatcaaggatatcgatgtgcagaggcta
gtactcagacaggatttcggaatgaatctggcgatactatgcattaatgatatgaagaag
cagatcgaaatcttgaataactcacgtgtaatcgtgccaaataacgaaaacggtgataac
aactatgtatctaaggggttcgatcatagtgggagataa

DBGET integrated database retrieval system