KEGG   Mycobacterium dioxanotrophicus: BTO20_02905Help
Entry
BTO20_02905       CDS       T05102                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
mdx  Mycobacterium dioxanotrophicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ART67670
UniProt: A0A1Y0BXP1
LinkDB All DBs
Position
633730..634851
Genome map
AA seq 373 aa AA seqDB search
MEPVDLPVAPPLEPMLAKAQVKVPDDAGVWSYEPKWDGFRALVFRDGNDVMLQSRSGKDL
GRYFPELLDALRDELVDRCVLDGEVVVPREITADARSKEITADGSTRVRLDWDSLSQRIH
PAESRIRMLAEQTPAHFIGFDALATGEKSLLDERFRIRREALVEAVHETQWCHVTRTTED
PALGTEWLTTFEGAGLDGVIAKRLDGPYLPGKREMVKVKHHRDADCVAIGYRIHKSGEGV
GSILLGLYRGDGELQMVGGAASFTAKDRVKLLADLEPLREGDEVREGDPSRWNSAADKRW
IPVRPERVCEVAYDQMEGNGMQAQRFRHAVKFLRWRPDREPSSCTFDQLDVPLNYDLYDV
LEQRGASEAPGGN
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggaacctgtggacctacctgtcgcgccgccgctggaacccatgttggccaaggcgcag
gtgaaagtgcccgatgacgccggcgtgtggtcgtatgagcccaagtgggacggcttccgg
gcgctggtctttcgggacggcaacgatgtgatgttgcagtcccgcagcggcaaagacctc
ggccggtactttcccgagctgctcgatgcgctgcgcgacgaactcgtcgaccgctgtgtg
ctggacggtgaagtggtggtgccgcgggagatcaccgcggacgcgaggagcaaagagatc
accgccgacgggagcacccgtgtccggctcgactgggactcgctgtcgcagcgcatccac
ccggccgaatcccggatccgcatgctggccgaacagacgcccgcgcacttcatcgggttc
gacgcgctggcgacgggcgagaagtccttgctcgacgagcggttccggatccggcgtgag
gctctggtcgaggcggtccatgagacgcagtggtgtcacgtcacccgcaccaccgaggat
cccgcgctgggcaccgagtggctcacgacgttcgagggcgccgggctcgacggtgtgatc
gccaagcggctcgacgggccgtatctgccgggcaagcgggagatggtgaaggtcaaacac
caccgcgacgccgactgtgtggccatcggctatcgcatccacaagagcggcgaaggtgtc
ggctcgatcctgctgggcttgtaccgcggcgacggcgagctccaaatggtcggtggcgct
gcgtcgttcaccgcgaaagatcgggtgaaactgcttgccgacctggagccgctgcgcgag
ggtgacgaggtgcgcgaaggtgatccgagccggtggaactcggcggcggacaagcgctgg
attccggtgcgccccgaacgggtatgcgaggtggcgtatgaccagatggagggaaacggc
atgcaggcccaaaggtttcggcacgcggtgaagttcctccggtggcggcccgaccgggaa
ccgtcgagttgcacgttcgaccagctcgacgtgccgctgaactacgacctctacgacgtc
ctggagcagcgcggggcgagcgaagcgccggggggtaattga

DBGET integrated database retrieval system