KEGG   Mycobacterium dioxanotrophicus: BTO20_08110Help
Entry
BTO20_08110       CDS       T05102                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mdx  Mycobacterium dioxanotrophicus
Pathway
mdx00071  Fatty acid degradation
mdx00280  Valine, leucine and isoleucine degradation
mdx00281  Geraniol degradation
mdx00310  Lysine degradation
mdx00360  Phenylalanine metabolism
mdx00362  Benzoate degradation
mdx00380  Tryptophan metabolism
mdx00410  beta-Alanine metabolism
mdx00627  Aminobenzoate degradation
mdx00640  Propanoate metabolism
mdx00650  Butanoate metabolism
mdx00903  Limonene and pinene degradation
mdx00930  Caprolactam degradation
mdx01100  Metabolic pathways
mdx01110  Biosynthesis of secondary metabolites
mdx01120  Microbial metabolism in diverse environments
mdx01130  Biosynthesis of antibiotics
mdx01212  Fatty acid metabolism
Module
mdx_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mdx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BTO20_08110
   00650 Butanoate metabolism
    BTO20_08110
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BTO20_08110
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BTO20_08110
   00310 Lysine degradation
    BTO20_08110
   00360 Phenylalanine metabolism
    BTO20_08110
   00380 Tryptophan metabolism
    BTO20_08110
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BTO20_08110
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BTO20_08110
   00281 Geraniol degradation
    BTO20_08110
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BTO20_08110
   00627 Aminobenzoate degradation
    BTO20_08110
   00930 Caprolactam degradation
    BTO20_08110
Enzymes [BR:mdx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BTO20_08110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ART68544
UniProt: A0A1Y0C097
LinkDB All DBs
Position
complement(1697926..1698699)
Genome map
AA seq 257 aa AA seqDB search
MSFETILVTRVDRVATITLNRPKALNALNSQVMNEVTTAAAELDNDPSVGAIIVTGNDKA
FAAGADIKEMAELSFADVYSADFFEQWSKFAATRTPTIAAVAGYALGGGCELAMMCDILI
AADTAKFGQPEIKLGVLPGMGGSQRLTRAIGKAKAMDLILTGRTIDAVEAERAGLVSRLV
PADSLIDEALAVAETIAGMSLSAARMAKEAVNRAFESSLTEGLLYERRLFHSAFATADQK
EGMAAFTEKRAPNFTHR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagctttgagacgatcctggtgacccgcgtcgaccgcgtcgccaccatcaccctgaac
cggcccaaggcgctcaacgcgctcaacagccaggtgatgaacgaagtcaccacggccgca
gccgaactcgacaatgacccgagcgtcggcgcgatcatcgtcacgggcaacgacaaggcg
ttcgccgcgggcgccgacatcaaggagatggccgagctgtcgttcgccgatgtgtactcg
gccgacttcttcgagcagtggtcgaagttcgcggccacgcggacgccgaccatcgccgcg
gtcgccgggtacgccctgggcggcggctgtgagctggcgatgatgtgcgacatcctgatc
gcagcggacaccgcgaagttcggtcagcccgagatcaagctcggcgtgctgcccggtatg
ggcggcagccagcggctgacgcgcgcgatcggcaaggccaaggcgatggacctgatcctg
accggccgcaccatcgacgcggtcgaggccgagcgggccgggctggtgtcgcggctggtg
ccggcggactcgctgatcgacgaggccctcgcggtcgcggagacgatcgcggggatgtcg
ctgtcggccgcacggatggccaaggaagccgtcaatcgcgccttcgagtcgtcgctcacc
gaagggctgctctacgagcggcggctgttccactcggcgttcgccacggccgatcagaag
gaaggcatggcggccttcaccgagaagcgcgccccgaacttcacgcatcgttaa

DBGET integrated database retrieval system