KEGG   Mycobacterium dioxanotrophicus: BTO20_09380Help
Entry
BTO20_09380       CDS       T05102                                 

Definition
(GenBank) dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
mdx  Mycobacterium dioxanotrophicus
Pathway
mdx00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:mdx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BTO20_09380
Enzymes [BR:mdx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BTO20_09380
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BTO20_09380
    1.1.1.-  
     BTO20_09380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: ART68768
UniProt: A0A1Y0C0T4
LinkDB All DBs
Position
1960328..1961383
Genome map
AA seq 351 aa AA seqDB search
MKAAVYYGPNKVEIADVPEPRPTEGTVKIKVGFNGICGTDLHEYYAGPIFVPTEPHPLTG
QQLPLTMGHEFSGTITEVGPGVTDYAPGDRVAIEPIYRCGHCSPCRAGNYNICQQIGFHG
LMSDGGMAEYTVVPVNMLHRLPDNVSLELGALVEPMSVAYHAATLGAVGPLHTAVVFGAG
PIGIGLWFALRGKGLESVFVAEPSPTRRAAIEALGAKTLDPTTTDVPAFVADHTDGRGAD
AAFDAAGVEPAIAAATACVGARKPTISVAIYEKPLTTPLLNLVMNESRIQGSLCYTSADF
EAVIDLMAHGVYDTKGWVTPIVIDDVIDEGFEALHAGKKMKVLVDPSGESA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagccgtgtattacggaccgaacaaggtcgagatcgccgatgtgcccgagcct
cgaccgaccgaagggaccgtcaagatcaaggtcggcttcaacggcatctgcggcactgac
ctgcatgaatactatgcggggccgatcttcgtgccaaccgaaccgcatccgctgaccggg
cagcagctgcccctgaccatgggtcacgagttctccgggaccatcaccgaggtcggcccg
ggtgtcaccgactacgcgccgggcgaccgggtggccatcgagccgatctaccggtgcggg
cactgcagcccgtgccgggcggggaactacaacatttgtcagcagatcggcttccacggc
ttgatgtccgacggcgggatggccgagtacaccgtggtccccgtcaacatgctgcaccgc
ctgcccgacaacgtgtcactggagttgggtgcgctcgtggagccgatgtcggtggcctat
cacgcggccaccctcggtgcggtcggtccgctgcacaccgcggtggtcttcggcgccggg
ccgatcggcatcgggctgtggttcgcattgcgcggcaagggcctggaatcggtgttcgtc
gccgaaccgtcgccgacccggcgggccgccatcgaggcgctcggcgccaaaaccctggac
ccgacgaccaccgacgtgcctgccttcgtcgccgatcacaccgacgggcggggcgccgac
gcggccttcgacgccgcgggtgtggagccggcgatcgcggccgccaccgcgtgcgtgggt
gcgcgcaagccgacgatcagcgtcgccatctacgagaagccgctgaccacgccgctgctc
aacctcgtgatgaacgaatctcgcatccagggatcgctgtgctacacctcggcggacttc
gaagccgtcatcgatctgatggcgcacggggtgtacgacacgaaaggctgggtcacgccc
atcgtcatcgacgatgtcatcgacgaggggttcgaagccctgcacgccggtaagaagatg
aaggtgctcgtcgacccgagtggagaatcagcatga

DBGET integrated database retrieval system