KEGG   Mycobacterium dioxanotrophicus: BTO20_11505Help
Entry
BTO20_11505       CDS       T05102                                 

Definition
(GenBank) hypothetical protein
Organism
mdx  Mycobacterium dioxanotrophicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transglycosylas PhageMin_Tail
Motif
Other DBs
NCBI-ProteinID: ART69123
UniProt: A0A1Y0C1R4
LinkDB All DBs
Position
2376382..2380260
Genome map
AA seq 1292 aa AA seqDB search
MGIPIPVEPQLDERTATAAANKAEKTFADAGKKAGQSFTNAFADGTRDVDQSVKKIGDKA
SDAYDKARDAAGRLRTEEEKLQKLRNEAASNDRIVAQVERVEKARRAEVRAVRDATDAYK
EYEDAAKNAGSGFLGGLHNAVSGVGQTGQEAANGFVEGFAGSSMLLRLGAAAGPIGLALA
GVATLGVVAGKELAQGISEGMARIQLQDQFQAAMGLNDASMARYASAAGHAFANNFGESL
ADNLAAARAALQAGLISPDSSDAMVQDVVQRLQGASQTSLGEASPQELARSATTLIRTGF
AHDTASAMDIITSGFQRGLNVSQDWLDTLNEYSTQFRKLGLDASEFMTLLNQGLEGGARD
TDKVADSLKEFSIRAVDGSKSTKEGFEALGFNAQEMGKRIAAGGDSAKVAFSAVLDKLRE
TDDEQQKALIWQRLFGTQWEDMGDAINRLSLDPAKREFTDLQGTSDRANKTATDNFKSQW
EGATKAVGQYFSDLKTDIADWFTSLPVIKDLPGQIKDAFTDRPGKPAGFWGPGISAPPDG
VLPQIQFPAGLSPRQLDDLKSRPHTFVPGAPVAGTPTPIPLDPDAAKAKPSFDPSQYSLD
AIPLGAFPGIVGSAGALGAPGVGQVQNGQIMWGTGNDPYAKPGYGYYQVDPQRVFDADSS
VMSARNSVEQARIRVLELEADNTTTAQELAAAKQAVVMAERGAISAQQKLAEAQQGTWKK
LENSAKQASKGMEDIGAALDNDLGISKGLPGLAENLTKFIANLAAAPLLGQLEAIKQANP
SQGGYGLMGILGARGVFGDRFTGVDYSKQPGYGYAPAGTAPAGTPALPGAGPVGAAKPGE
SAREFAHRVMMPFWQNQGLTVGDHAADKYGEHQNGALDIMVPSIAEGQKVLQQVLSDPNV
YGAIFNNQTYGYGHGLTPQDYSAGHTGNPTQDHQDHVHAWYKPGGSDNINPTGAPVPGAS
AAAAPAVAAPAAGGATPVFVTNWPGSQGSAPGIASSSGAPSSAAPSTGLSTEQWNNIAEA
ESGGEWAINSGNGFSGGLQFDPNTWKAFGGTQYAPEAWQATPEQQMAVGNNVLAGQGPSA
WPATSTAHPEWFQPTAGAYGTGAPLPTRWGGGGGPGMGMPNAAPFALNSPIGGVAFPSQP
GGGFQGVSGAPMDAAMMAAGGLDLLAPGAGQAAQMGMKLANRAIGYAGQLAGIGVSGLME
TFLPSGSPLGNIGNSWFGKLASVFAGARPALPNVAGQQAPPNPNAQQQGQQQGGKGDTNI
ELNYTNQGATEDRAGADLTRHLEATNAPAGVR
NT seq 3879 nt NT seq  +upstreamnt  +downstreamnt
ttgggcatcccgattcccgttgaaccgcagctcgatgagcgcaccgccaccgccgcggcg
aacaaggctgagaagacgttcgccgatgcgggcaagaaggccggccagtcattcaccaac
gcgttcgccgacggcacccgggacgtcgaccagtcggtcaagaagatcggcgacaaagcc
tctgacgcctacgacaaggcgcgcgacgccgcgggccggttgcgcaccgaagaggagaag
ctacagaagctgcgcaacgaggccgcatcgaatgatcggatcgtcgcgcaggtcgagcgg
gtggagaaagcccggcgtgcggaagtccgtgctgtccgcgatgcgacggacgcctacaaa
gagtacgaggacgccgcgaagaacgccggctcagggttcctcggcgggctccacaacgcg
gtgtcaggcgttggacagaccgggcaggaagcagcgaacgggttcgttgagggcttcgcc
ggctcgtcgatgctgctgcggttgggcgccgcagccgggccgatcggactggcccttgct
ggtgtggcaactctgggggttgtggcgggtaaggaactcgctcaaggcatctccgagggt
atggctcgcattcagttgcaggatcagttccaggcggcgatggggctcaacgatgcgtcg
atggcccggtatgcgtctgcggctggccacgcgttcgcgaacaacttcggtgaatcgttg
gccgacaacctcgccgccgcccgggcggcgttacaggcggggttgatctctccggattcg
tcggacgcaatggtccaggacgtggtgcagcggctgcagggcgcgtcgcaaaccagcctc
ggtgaggcgtcgccgcaggagttggcgcgctcggcgaccacattgattcggaccgggttc
gctcatgacacggccagcgcgatggacatcatcacgtccgggttccagcggggcctgaac
gtgtcgcaggactggctggacaccctcaatgagtactccacccagttccgcaagcttggg
ctggatgcgagcgagttcatgaccctgctcaaccaggggctcgagggtggcgctcgggat
acggacaaggtggcggattcgctgaaggagttcagcattcgcgctgttgacgggtcgaag
tccaccaaggagggtttcgaggcgctcgggttcaatgcgcaggagatggggaagcggatc
gccgccggtggggattcggcgaaggtggctttctccgctgtcctggacaagctgcgtgag
accgatgatgagcagcagaaggcgttgatctggcagcggttgttcggcacccagtgggag
gacatgggtgacgcgatcaatcgactgagcttggatccggcgaagcgcgagttcactgat
ctgcagggcacttcggatcgtgcgaataagacggcgacggacaacttcaagtcgcagtgg
gagggtgcgaccaaggctgttgggcagtacttttcggacctgaagacggatatcgctgat
tggtttacgagcctgccggtgatcaaggatctgccggggcagatcaaggatgcgttcacg
gatcgcccgggtaagccggctggtttctgggggccggggatttccgcgccgcctgatggg
gtgctccctcagattcagttccccgctgggttgtcgccgcggcagctggatgacctgaag
agcaggccgcacacgttcgtgccgggcgctccggtggcgggcacgccgacgccgatccct
ttggatcctgatgcggcgaaggcgaagccgtcgttcgatccgtcgcagtactcgctcgat
gcgatcccgttgggcgcattccctggcattgttgggtcggctggcgcactgggtgctccg
ggtgttgggcaggtgcagaacggccagatcatgtggggcaccggcaatgacccgtatgcg
aagccgggatatggctactaccaggtggatccgcagcgggtttttgacgcggattcgtcg
gtgatgtcggcgcgcaacagtgtggagcaggcccgcatccgggtgttggagttggaggcg
gacaacaccacgaccgcgcaggaattggcggctgccaagcaggcggtggtcatggccgag
cgcggtgccatctcggcgcagcagaagctggctgaggcgcagcagggtacctggaagaag
ctggagaactcggccaagcaggcgtcgaagggcatggaggacatcggtgccgcgctcgac
aacgatctgggtatttcgaagggcttgccggggctcgcggagaacctgacgaagttcatc
gcgaacctcgctgccgcaccactgttggggcagttggaggcgatcaagcaggccaaccca
tctcagggtggctacgggctgatgggcatcctgggcgcccggggcgtgttcggtgaccgg
ttcaccggtgtcgactacagcaagcagccgggctacggatacgcaccagcagggactgcc
ccagcggggacgccagcgctgccaggagctggtccggtgggcgcagccaaacctggtgaa
tctgcgcgggagttcgcgcatcgggtgatgatgccgttctggcagaaccagggcctcacg
gtcggagaccacgccgcagacaagtacggggagcaccagaacggcgccctcgacatcatg
gtgccgagcatcgccgaagggcagaaggttctccagcaggtgctgtccgaccccaacgtc
tacggcgcgatcttcaacaaccagacgtacggctacggccacggcctgaccccccaggac
tacagcgcagggcataccggcaatccgacgcaggaccaccaagatcatgttcacgcttgg
tacaagcccggaggtagcgacaacatcaatccgacgggtgcgcccgtgccgggagcatct
gctgccgctgcgcccgctgtcgctgcgccagcggctggtggtgcgaccccggtattcgtc
acgaactggcccggatcgcagggttccgcacctggcatcgcttcgtcgagcggcgctcca
tcgagcgcggctccgtcgactggacttagcacggagcagtggaacaacatcgccgaagct
gaatctggcggcgaatgggcgatcaactcgggcaacggcttttctggtgggctgcagttc
gatccgaacacttggaaagcgttcggtggcactcagtacgccccggaggcgtggcaggcg
acccctgagcagcagatggcggtaggcaacaacgtgctggccgggcagggcccgagcgcg
tggccggcgacgtcgacggcgcacccggagtggttccagccgacggcgggcgcgtacggc
actggtgcgccgctgcccactcggtggggtggtggcggcggtccgggtatggggatgccg
aatgccgcaccgtttgccctcaacagtccgatcggtggtgtcgccttcccgtcgcagccc
ggcggtggattccaaggcgtttcgggcgctccgatggacgcggccatgatggccgccggg
ggactggatctgctcgccccaggtgccggtcaggccgcccaaatgggcatgaaactcgcg
aaccgcgccatcggctacgccggtcagctcgccggtatcggcgtgtccggactgatggag
accttcctgccatccggttcaccgctggggaatatcggcaactcgtggttcggcaagctc
gcgtccgttttcgcaggcgcccggcccgcgctgccgaacgtggccgggcagcaggccccg
ccgaatccgaacgcccagcagcaggggcagcagcaaggtggaaagggtgacaccaacatc
gagctgaactacaccaaccagggcgccaccgaggaccgtgccggagctgacctgacacgc
cacctggaggctacgaacgccccggctggggtgcggtga

DBGET integrated database retrieval system