KEGG   Mycobacterium dioxanotrophicus: BTO20_18515Help
Entry
BTO20_18515       CDS       T05102                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mdx  Mycobacterium dioxanotrophicus
Pathway
mdx00620  Pyruvate metabolism
mdx00680  Methane metabolism
mdx01100  Metabolic pathways
mdx01120  Microbial metabolism in diverse environments
mdx01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mdx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BTO20_18515
  09102 Energy metabolism
   00680 Methane metabolism
    BTO20_18515
Enzymes [BR:mdx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BTO20_18515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ART70290
UniProt: A0A1Y0C524
LinkDB All DBs
Position
complement(3870486..3873275)
Genome map
AA seq 929 aa AA seqDB search
MAEAFDTTLLPIGSVYRTQVGREATEPMREDIRLLGTILGDTVREQNGEEVFDLIERARV
ESFRVRRSEIDRAELAGLFGGIDVHQAIPVIRAFTHFALLANVAEDIHRERRRAVHVAAG
EPPQDSSLAATYRKLDSAALDAAAVADALTGALVSPVITAHPTETRRRTVFDTQHRITEL
MRLRLHGQTRTADDRDIEVELRRHILTLWQTALVRLSRLKISDEIETGLRYYPAAFFEVI
PQVNAQVRSELQSRWPDAGLLEVPILRPGSWIGGDRDGNPNVTPEIVRLATGRAAYTALG
HYFTEITALEEELSLSVRLVRVSPELTALADACTEPARADEPYRRALRVIHGRLTATAAE
ILDEQPEQVLDLGLTAYRTPAELLADLDTVDASLRGHGSAVLADDRLGRLREAVRVFGFH
LCGLDMRQNSETHEQVVAELLAWAGVHPDYASLPEAERVELLAAEVATRRPLIGEGAQLS
ELARKELGIVAAAARAVKVLGPEAVPNYIISMCQSVSDLLEAAVLLKEAGLLDVSTGYCP
VGIVPLFETIDDLQRGSTILEDALDLPVYREIVTARDQQQEVMLGYSDSNKDGGYLAANW
ALYRAELDLVESARKTGIRLRLFHGRGGTVGRGGGPSYDAILAQPPGAVKGSLRITEQGE
VIAAKYAEPRIAHRNLETLLAATLESTLLDVEGLGDEAGPAYAVLDDLAARAQRAYAELV
HDTPGFVDYFKASTPVSEIGALNIGSRPTSRKPTTSIADLRAIPWVLAWSQSRVMLPGWY
GTGTAFEEWIAEGDGRLEVLQDLYQRWPFFATVLSNMAQVLAKSDMGLAARYSELVDDED
LRARVFDKIVAEHERTIRMHRLITGQDDLLADNPALARSVFNRFPYLEPLNHLQVELLRR
YRSGDTDELVQRGILLTMSGLATALRNSG
NT seq 2790 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggctttcgacaccaccctgttgcccatcggttcggtgtaccgcacccaggtg
ggccgggaagccaccgagccgatgcgcgaggacatcagactgctcggcacgatcctcggc
gacaccgtgcgggaacagaacggcgaggaggtgttcgacctcatcgaacgtgcccgggtg
gaatcgttccgcgtccggcgctccgagatcgaccgagcggagctggccggcctgttcggc
ggtatcgatgtccaccaggccattccggtcatccgggccttcacccacttcgcgctgctg
gccaacgtggccgaggacatccaccgggaacggcgccgcgcggtgcacgtggcggcaggc
gaacccccgcaggacagcagcctggcggccacctaccgcaagctggactcggcggctctc
gacgctgccgccgttgccgacgcgctgacgggcgcgctggtctcgcccgtcatcaccgcg
catcccaccgaaactcggcgccgcacggtgttcgacacccagcaccgcatcaccgagctg
atgcggttgcggctgcacggccagacccgcaccgccgacgaccgcgacatcgaggtcgag
ctgagacgccacatcctgacgctgtggcagacggcgttggtgcggctgtcccggctgaag
atctccgacgagatcgaaaccggcctgcggtactacccggcggcgttcttcgaggtcata
ccgcaggtcaacgcccaggtgcgcagcgagctgcagagccgctggcccgacgccggactg
ttggaggtcccgatcctgcggccggggtcgtggatcggcggcgaccgcgacggcaacccc
aacgtcacaccggagatcgtccggctggccaccggccgggccgcgtacacggcgctcggg
cactacttcaccgagatcaccgctctggaggaagagctgtccctgtcggtgcgcctcgtc
cgggtcagcccggagctcaccgcgctcgccgatgcctgcaccgagccggcacgcgccgac
gagccgtatcggcgcgcgctgcgcgtgatccacgggcgtctcacggccaccgccgccgag
atcctcgacgagcagcccgaacaggtgctcgacctggggctgaccgcgtaccgcacgccc
gccgaattgctcgccgacctcgataccgtcgatgcgtcactgcgcgggcacggcagcgcc
gtactggccgatgatcgcttgggccgcctgcgagaggccgtgcgggtcttcggttttcat
ctgtgcggcttggacatgcggcagaactcggagacacacgagcaggtcgtcgccgagcta
ctggcctgggccggagtgcatcccgactacgcgtcgttgccggaggccgagcgggtcgag
ctgctcgccgccgaggtggccacccgccgcccgctgatcggcgagggcgcgcagctctcg
gaactggcgcgcaaggaactcgggatcgtcgccgcggcggccagggcggtcaaggtgctc
ggccccgaggcggtgcccaactacatcatctcgatgtgccagtcggtctccgatctgctg
gaggccgcggtgctgctgaaagaggctgggctgctggatgtttcgaccgggtactgcccg
gtcgggatcgtgccgctgttcgagaccatcgacgacctgcagcgcggttcgacgatcctg
gaggatgcgctggacctgccggtgtaccgcgagatcgtcaccgcgcgcgaccagcagcag
gaagtgatgctcggctactcggactccaacaaggacggtggctatctggccgccaactgg
gccctgtaccgtgccgaactcgacctcgtggagtcggcacgtaagaccggaatccggttg
cggctcttccacggtcgcggtgggaccgtcggccgcggcggcggccccagctatgacgcc
atcctggcccaaccgcccggcgcggtgaagggctcgctgcgcatcaccgaacagggcgag
gtgatcgcggccaagtacgccgaaccccggatcgcgcaccgcaacctggagactctactg
gcggccaccctggaatcgaccctgctcgacgtcgaaggcctcggcgacgaggccgggcct
gcgtacgccgtgctcgacgacctcgcggcccgggctcagcgggcctacgccgaattggtg
cacgacacaccgggtttcgtcgattacttcaaggcgtccacaccggtcagcgagatcggc
gcgctcaacatcggcagcaggccgacttctcgcaagccgaccacctcgattgccgatctg
cgtgccatcccctgggtgctggcctggagccagtcgcgcgtcatgctgccgggctggtac
ggcaccgggacggcgttcgaggaatggatcgccgagggggacgggcgactggaggtgctg
caagatctgtaccagcgctggccattcttcgcgaccgtgctgtccaacatggcccaggtg
ctcgccaagtccgatatgggcctggcagcgcggtattcagagctggtcgacgatgaggat
ctgcgggcccgggtgttcgacaagatcgtcgccgaacacgagcgcaccattcgcatgcac
cggctgatcaccggccaggacgatctgctggccgacaacccggcgctggcccgctcggtg
ttcaaccggttcccgtacctggagccgctcaaccatctgcaggtggaactgttgcggcgc
taccgttccggggacaccgacgagctggtgcagcgtggcatcctgctcaccatgagtggg
ctggccaccgcgttgcgcaacagcggttag

DBGET integrated database retrieval system