KEGG   Mycobacterium dioxanotrophicus: BTO20_19380Help
Entry
BTO20_19380       CDS       T05102                                 

Definition
(GenBank) galactose-1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
mdx  Mycobacterium dioxanotrophicus
Pathway
mdx00010  Glycolysis / Gluconeogenesis
mdx00052  Galactose metabolism
mdx01100  Metabolic pathways
mdx01110  Biosynthesis of secondary metabolites
mdx01120  Microbial metabolism in diverse environments
mdx01130  Biosynthesis of antibiotics
Module
mdx_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:mdx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BTO20_19380
   00052 Galactose metabolism
    BTO20_19380
Enzymes [BR:mdx01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     BTO20_19380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ART70437
UniProt: A0A1Y0C5R5
LinkDB All DBs
Position
complement(4058358..4059548)
Genome map
AA seq 396 aa AA seqDB search
MRGRGLLRLMAIAGVAGLTACSTTTHSGGDSSTGPAPAQAPSITDESFGQVGGTPVTRYT
LNSGHGMQVRILNYGGIIQSIEVPDRNGQANNVVLGFPNLEGYLNNTGDAKTYFGAIIGR
YGNRIAKGTFSLDGAPHQVPINNNGNSLHGGTAGFDSKVWQATPQNANGSVALKLQYLSP
AGEMGYPGALTTTVIYTVDQNNQLRIDYHATTDAPTVVNLTNHSYFNLAGEDALNIYDHK
LTISADSYTPTDTTQIPTGQIAPVKGTPFDFTSPTLIGAHITANDPQLLLAHGYDHNWVI
NRGNDTGLVQAAKAEDPATGRTLTVSTTEPGVQFYTSNFLVGAFTGTSGHIYRQGAGFTM
ETQHFPDSPNQPGFPSTILNPGQTYDSATVFAFGTG
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgcgtggacgaggtttacttcgactgatggcgatcgccggtgtggcgggcttgacggca
tgcagcaccacgacccacagcggcggcgacagcagcacagggcctgcgccggcccaggcg
ccgtcgatcaccgacgagtcgttcggccaagtgggcggcactccggtgacccgttacacg
ctcaacagcgggcacggcatgcaggtgcgaatcctcaactacggcggcatcattcagtcg
atcgaggtacccgaccgcaacgggcaggccaacaacgtggtgctcggtttcccgaatctg
gagggatatctcaacaacaccggcgacgccaagacctacttcggtgccatcatcggccgc
tacggtaaccggatcgccaagggaaccttctcgctcgacggcgcgccgcatcaggtcccg
atcaacaacaacggcaacagcctgcacggcggcaccgcaggattcgactcgaaggtatgg
caggccacgccgcagaacgccaacggcagcgtcgccctcaaactccaatacctcagtccg
gcaggtgaaatgggttatccgggagcgctgacgaccaccgtcatctacaccgtcgaccag
aacaatcaactgcgcatcgactatcacgccaccaccgacgccccgaccgtggtcaatctg
accaatcacagctacttcaacctggcgggggaggacgcgctcaacatctatgaccacaag
ctcaccatcagcgccgacagctacaccccgacggacaccacacagatcccgaccggccag
atcgccccggtgaaaggaacaccgttcgatttcacctcaccgacgctgatcggcgcacac
atcaccgccaacgacccccagttgctgctggcccacggctatgaccacaactgggtgatc
aaccgcggcaacgacaccggcttggtgcaggccgccaaggccgaggatccggcgaccgga
cgcacgctgaccgtctccaccaccgagccgggcgtgcagttctacacctcgaacttcctg
gtcggcgcgttcacgggcaccagcggccacatctaccggcaaggcgcgggcttcacgatg
gagacccagcacttcccggactcgcccaaccaaccggggtttccctccacgatcctcaat
ccagggcaaacctacgattcggcaacggttttcgccttcggcaccgggtag

DBGET integrated database retrieval system