KEGG   Mycobacterium dioxanotrophicus: BTO20_27595Help
Entry
BTO20_27595       CDS       T05102                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mdx  Mycobacterium dioxanotrophicus
Pathway
mdx00250  Alanine, aspartate and glutamate metabolism
mdx00410  beta-Alanine metabolism
mdx00430  Taurine and hypotaurine metabolism
mdx00650  Butanoate metabolism
mdx01100  Metabolic pathways
mdx01110  Biosynthesis of secondary metabolites
mdx01120  Microbial metabolism in diverse environments
mdx02024  Quorum sensing
Module
mdx_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mdx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BTO20_27595
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BTO20_27595
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BTO20_27595
   00430 Taurine and hypotaurine metabolism
    BTO20_27595
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BTO20_27595
Enzymes [BR:mdx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     BTO20_27595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ART71803
UniProt: A0A1Y0C986
LinkDB All DBs
Position
complement(5691312..5692691)
Genome map
AA seq 459 aa AA seqDB search
MSRKHSHAQVAPAYTGRLDMAPVPALRLPDDAMEPAAAYRFIHDELMLDGSSRLNLATFV
TTWMDDEAGKLMAETFDKNMIDKDEYPATAAIETRCVNMVADLFHAEDLRDDDPASATGV
STIGSSEAVMLAGLALKWRWREKVGDGWKGRTPNLVMGSNVQVVWEKFCRYFDVEPRYLP
MTEGRYVITPEQVLGAVDEDTIGVVGILGTTFTGELEPIAEICAALDELAAGGGVDVPVH
VDAASGGFVVPFLHPDLQWDFRLPRVVSINVSGHKYGLTYPGIGFVVWRSKDHLPEDLVF
RVNYLGGDMPTFTLNFSRPGNQVVGQYYNFLRLGRAGYTQVMQCLSQTARWLGDELRASE
HFEIISDGSAIPVISFRLTGDPGYTEFDVSQALRAFGWQVPAYTMPDDASEVVVLRIVVR
EGFSADLARALKEDMITALGHLDKLKPGGFFDRVQPFTH
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgcaagcattcccacgcccaagtcgctccggcctacaccggacggctggacatg
gcgccggtcccggcgctgcgcctgcccgacgacgcgatggaacccgctgcggcgtacagg
ttcatccacgacgagctgatgctcgacggcagctcgcggctgaacctggcgaccttcgtc
accacctggatggacgacgaggccggcaagctgatggcggagacgttcgacaagaacatg
atcgacaaggacgagtacccggcgaccgcggccatcgagacgcggtgcgtgaacatggtc
gccgacctcttccacgccgaagacctgcgcgacgacgacccggcgagtgccaccggggtc
tccaccatcggatcgagcgaggccgtgatgctggccggcctggccctgaaatggcgctgg
cgcgagaaggtcggcgacggctggaagggccggacgcccaatctggtgatgggctccaac
gttcaggtggtgtgggagaagttctgccgctacttcgacgtggaaccgcgatatctgccg
atgactgaggggcgctacgtcatcaccccggaacaggtgctcggcgcggtcgacgaggac
accatcggcgtcgtcggcatcttgggcaccacgttcaccggtgagctcgaaccgatcgcc
gagatctgcgcggcgctcgacgaactggcggctggtggcggtgtcgatgtcccggtgcac
gtcgacgcggccagcggtggcttcgtggtgccgttcctacaccccgacctgcagtgggac
ttccggctgccgcgggtggtgtcgatcaacgtcagcgggcacaagtacgggctgacctat
ccgggcatcgggttcgtggtgtggcgcagcaaagaccacctgcccgaagacctggtgttc
cgggtgaactacctgggcggggacatgccgacgttcaccctgaacttctcgcggcccggc
aaccaggtggtcggccagtactacaacttcctgcgcctgggccgggccggatacacccag
gtcatgcagtgcctgtcacagaccgcgcgctggctgggcgacgagctgcgggccagcgag
cacttcgagatcatctccgacggatcggccatcccggtgatcagcttccggctcaccggc
gatccggggtacaccgagttcgacgtgtcgcaggcgctgcgcgcgttcggttggcaggtt
ccggcctacaccatgcccgacgacgcgtccgaggttgtcgtgctgcggatcgtggtccgt
gagggtttctcggccgacctggcccgggccctcaaggaagacatgatcaccgccctgggc
cacctcgacaaactcaagccgggtggattcttcgaccgggtgcagcccttcacgcactga

DBGET integrated database retrieval system