KEGG   Mycobacterium dioxanotrophicus: BTO20_31585Help
Entry
BTO20_31585       CDS       T05102                                 

Definition
(GenBank) superoxide dismutase, Ni
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
mdx  Mycobacterium dioxanotrophicus
Brite
KEGG Orthology (KO) [BR:mdx00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BTO20_31585
Enzymes [BR:mdx01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BTO20_31585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni Phage_clamp_A
Motif
Other DBs
NCBI-ProteinID: ART72497
UniProt: A0A1Y0CBS0
LinkDB All DBs
Position
6505067..6505471
Genome map
AA seq 134 aa AA seqDB search
MRLPSFLAPRVIARAHCDLPCGVYDPAQARIEAESIKAIAEKYQANEDPEFRTRALIIKE
QRSELVKHHLWVLWTDYFKPPHFEKYPQLHQLVNEATKLAGASGTKGSVDPEVAQQLLDK
IDEIAKIFWETKKS
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgcgactgccgtccttcctcgccccccgcgtcatcgcccgtgcacactgcgacctgcct
tgcggtgtgtacgacccggcccaggcgcggatcgaggccgaatcaatcaaggccatagcg
gagaagtaccaggccaatgaggaccccgagttccgcacccgcgcgctgatcatcaaggaa
cagcgttcggaactggtcaagcaccatctctgggtgctgtggaccgactatttcaagccg
ccccacttcgagaaatacccccagctgcatcagctggtgaacgaggcgaccaagctggcc
ggcgcatccggcaccaagggctcggtcgacccggaggtggcgcaacagctcctcgacaag
atcgacgagatcgccaagatcttctgggagaccaagaagtcctga

DBGET integrated database retrieval system