KEGG   Mycobacterium dioxanotrophicus: BTO20_32780Help
Entry
BTO20_32780       CDS       T05102                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
mdx  Mycobacterium dioxanotrophicus
Pathway
mdx00220  Arginine biosynthesis
mdx00250  Alanine, aspartate and glutamate metabolism
mdx00290  Valine, leucine and isoleucine biosynthesis
mdx01100  Metabolic pathways
mdx01110  Biosynthesis of secondary metabolites
mdx01130  Biosynthesis of antibiotics
mdx01210  2-Oxocarboxylic acid metabolism
mdx01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mdx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BTO20_32780
   00290 Valine, leucine and isoleucine biosynthesis
    BTO20_32780
   00220 Arginine biosynthesis
    BTO20_32780
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mdx01007]
    BTO20_32780
Enzymes [BR:mdx01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     BTO20_32780
    2.6.1.66  valine---pyruvate transaminase
     BTO20_32780
Amino acid related enzymes [BR:mdx01007]
 Aminotransferase (transaminase)
  Class I
   BTO20_32780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP Alliinase_C Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ART72705
UniProt: A0A1Y0CCM2
LinkDB All DBs
Position
6766098..6767372
Genome map
AA seq 424 aa AA seqDB search
MVDVTTHQLPWQGTGHHPKPRVFAQSTKLQDVLYEIRGPVHEHASRLEAEGHRILKLNIG
NPAPFGFEAPDVIMRDIIQALPYAQGYSDSKGILSARRAVFTRYELVEGFPRFDVDDVFL
GNGVSELITMTLQALLDNGDQVLIPTPDYPLWTASTSLAGGTPVHYLCDETQGWNPDVAD
LESKITDRTKAIVVINPNNPTGAVYSRETLTQIADLARKHQLMLLADEIYDKILYDDAKH
ISMASVAPDVLTLTFNGLSKAYRVAGYRSGWLVITGPKEHASSFIEGISLLANMRLCPNV
PAQHAIQVALGGHQSIDDLVLPGGRLLEQRDTAWTKLNEIPGVSCVKPSGALYAFPRLDP
EVHDIQDDEQLVLDLLMQEKILLTQGTGFNWPTPDHLRIVTLPWSRDLSAAIERLGNFLA
SYRQ
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggtggacgtgactacccatcagctgccgtggcagggtaccgggcaccacccgaagcca
cgtgtgttcgcccaatcgacgaagctgcaggatgtcctgtacgagattcgcgggccggta
cacgagcacgcctcgcggctggaagctgaaggccatcgcatcctcaagctgaacatcggc
aacccggcgccgttcggcttcgaggctcccgacgtgatcatgcgcgacatcatccaggca
ctgccgtacgcgcagggctactccgactccaagggcattctcagcgcccgccgtgcggtg
ttcacccgctacgagctggtggagggattcccccggttcgacgtcgacgacgtcttcctc
ggcaacggtgtctccgagctgatcaccatgaccctgcaggccctgctcgacaacggcgat
caggtgctgatccccacgccggactacccgctgtggaccgcgtcgacctcgttggccggc
ggcactccggtgcactatctgtgcgacgagacgcagggctggaaccccgacgtcgccgac
ctggaatccaagatcaccgatcgcaccaaggcgatcgtcgtgatcaacccgaacaacccg
acgggcgcggtgtacagccgcgaaaccctcacgcagatcgccgatttggcgcgcaagcat
cagctgatgctgctggccgacgagatctacgacaagatcctctacgacgacgccaagcac
atctccatggcgtcggtggcgccggacgtgctgacgctgaccttcaacgggctgtccaag
gcgtaccgggtcgccggataccggtccggctggctggtgatcaccggccccaaggagcac
gcaagcagcttcatcgaaggcatcagcctgctggccaacatgcggttgtgtccgaatgtg
cctgcgcagcacgctattcaggtggcactcggcggccatcagagcatcgacgatctggtg
ctgcccggcggccggttgctggaacagcgcgacaccgcatggaccaagctcaacgagatc
cccggggtgtcctgcgtgaagccctccggggcgctctacgcgttcccgcgactggatccc
gaggtccacgacatccaggacgacgagcaactcgtactcgacctgctcatgcaggagaag
atcctgctgacgcagggcaccggattcaattggcccacaccggatcacctgcgcatcgtc
accctgccgtggtcgcgtgacctgtccgccgcgatcgaacgtctcggcaacttcctggcc
agctaccggcagtag

DBGET integrated database retrieval system