KEGG   Mycobacterium dioxanotrophicus: BTO20_33290Help
Entry
BTO20_33290       CDS       T05102                                 

Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
mdx  Mycobacterium dioxanotrophicus
Pathway
mdx00250  Alanine, aspartate and glutamate metabolism
mdx00280  Valine, leucine and isoleucine degradation
mdx00310  Lysine degradation
mdx00410  beta-Alanine metabolism
mdx00640  Propanoate metabolism
mdx00650  Butanoate metabolism
mdx01100  Metabolic pathways
mdx01120  Microbial metabolism in diverse environments
Module
mdx_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mdx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BTO20_33290
   00650 Butanoate metabolism
    BTO20_33290
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BTO20_33290
   00280 Valine, leucine and isoleucine degradation
    BTO20_33290
   00310 Lysine degradation
    BTO20_33290
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BTO20_33290
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mdx01007]
    BTO20_33290
Enzymes [BR:mdx01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BTO20_33290
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     BTO20_33290
    2.6.1.48  5-aminovalerate transaminase
     BTO20_33290
Amino acid related enzymes [BR:mdx01007]
 Aminotransferase (transaminase)
  Class III
   BTO20_33290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ART72790
UniProt: A0A1Y0CBY7
LinkDB All DBs
Position
complement(6878367..6879707)
Genome map
AA seq 446 aa AA seqDB search
MTTTELSAIAQERRLVTAIPGPVSQQMHARKESAVARGVGATLPVYVVAAGGGILVDADG
NQLIDFGSGIAVTTVGNSAPAVVDAVSQQVAAFTHTCFMVTPYEGYVRVAEELNRLTPGD
HDKRTVLFNSGAEAVENAVKIARAHTRRQAVVVFDHAYHGRTNLTMAMTAKNQPYKNGFG
PFAGEVYRVPTSFPLRDGEIDGAAAAARAIDLIEKQVGAENVAAVVIEPIHGEGGFIVPA
PGFLGALQNWCTTAGAVFVADEVQTGFARTGAMFACEHEGLVPDLIVTAKGIAGGLPLSA
VTGRAEIMDAPHAGGLGGTYGGNPLACAAALAVVETIEREQLVARAAAMGETMISRLTAM
AAGDPRIGDVRGRGAMVAIELVKPGTIEPDADLTKRVAAAAHAQGLVVLTCGTYGNVLRF
LPPLSMPDHLLNEGLDILAAAFAEIA
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaccacggagctttcggccatcgcacaggaacgccggctcgtcacagccattccc
ggacccgtctcgcagcagatgcacgcccgcaaggagtccgcggtggcccgcggcgtcgga
gccaccctgccggtgtacgtcgtcgccgccggcggcggcatcctggtcgacgcggacggt
aaccagctcatcgatttcggttccggcatcgccgtgaccaccgtcggcaacagcgccccg
gccgtcgtcgacgccgtcagccagcaggtcgcggccttcacgcacacctgcttcatggtc
acgccctacgagggttacgtacgggtcgccgaggaactcaaccggctcaccccgggtgat
cacgacaagcgcaccgtgctgttcaactccggcgccgaggctgtcgagaacgcggtcaag
atcgcccgcgcccacacccgccgccaggccgtcgtcgtgttcgaccacgcctaccacggc
cgcaccaacctgaccatggcgatgactgccaagaaccagccgtacaagaacggcttcggg
ccgttcgccggcgaggtgtaccgcgtgccgacctcgttcccgctgcgcgacggcgagatc
gacggcgccgccgcggccgcccgggccatcgacctcatcgagaagcaggtcggcgccgag
aacgtcgccgccgtggtcatcgagccgatccacggcgagggtggcttcatcgtccctgct
cccggcttcctgggcgctctgcagaactggtgcacgaccgcgggcgcggtgttcgtcgcc
gacgaggtgcagaccgggttcgcccgcaccggcgcgatgttcgcctgcgagcacgagggc
ctcgtgccggacctgatcgtcaccgccaagggcatcgcaggcggcctgccgctgtccgcg
gtcaccggccgcgccgaaatcatggacgccccgcacgcgggtgggctcggcggcacctac
ggcggcaacccgctcgcctgtgcggcggccctcgccgtcgtcgagaccatcgagcgtgag
cagctcgtcgcgcgggccgcggccatgggggagaccatgatcagccggctcaccgcgatg
gccgcgggcgatccgcggatcggcgatgtgcgtggtcgcggcgccatggtcgccatcgag
ctggtcaagcccggcaccatcgagcccgatgccgatctgaccaagcgcgtcgccgccgcg
gcgcatgcccagggcctggtcgtcctcacctgcggcacctacggcaacgtgctgcgcttc
ctgccgccgctgtcgatgcccgaccacctgctcaacgaaggtctggacatcttggccgcc
gccttcgcggagatcgcatga

DBGET integrated database retrieval system